DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2145 and si:dkey-222f8.3

DIOPT Version :9

Sequence 1:NP_001285102.1 Gene:CG2145 / 32027 FlyBaseID:FBgn0030251 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001038432.1 Gene:si:dkey-222f8.3 / 561722 ZFINID:ZDB-GENE-030131-3658 Length:290 Species:Danio rerio


Alignment Length:281 Identity:99/281 - (35%)
Similarity:143/281 - (50%) Gaps:22/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 TDDEIRQLTELLYTKESNSQI--GNIQVNLQGRT-----RSIDSADEAPNPLLT-VDSKALES-P 384
            |:.|:..|...|:..:.|...  .:.:::|||:.     .|..:.|.|..||.: |:...|:| .
Zfish     7 TNQELSNLLNELWKLDVNRMKPGRDYKIDLQGKAGFVSEGSNSARDCARAPLFSHVNENKLKSID 71

  Fly   385 TIVKMRLLFNNYEHDTHVNEHVTPNERKEENDFLDAVMATPVMRQAMLFLQQKGVVSPDPKTHRD 449
            |......|.:|||..|.|.|.||..|.:|.:.|||||:.|.||:.|..:|..||....|....:.
Zfish    72 TYAYFITLLDNYETSTGVAEQVTKEELQENSLFLDAVLKTEVMKCAHRYLVSKGRAQSDMAQFKR 136

  Fly   450 LVKELWFTQYSRGQ-GKIGSSGFEHVFVYEVKDG-TIIGFHNWVYIGDEEKDGRFDYKGYMKEQD 512
            .:.::||..|.|.: |...|.|||||||.|.|.| .|:|.|||:...:.||....|||||.....
Zfish   137 QLYDIWFKLYRRDKSGAEDSCGFEHVFVGETKHGREIMGLHNWIQFYNLEKQNIVDYKGYKARDK 201

  Fly   513 IGTKGK---IVKIRFSHQGLNKPVNTVFVGTSPELELALYTVCFQLRPDRTCPVSLGNSKF--GI 572
            ..|..:   ::.::||..||.|||...|:|.|||.|:||||:.|.|..:....|.:...::  .|
Zfish   202 KDTPDEDDHVLNLQFSWNGLVKPVGGCFIGVSPEFEVALYTIIFLLSGEHMTNVRVKVDEYLLEI 266

  Fly   573 VTYSW-RYRGKNLIGSAYPEI 592
            |.|.: ||     ||::||::
Zfish   267 VVYRFGRY-----IGTSYPKL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2145NP_001285102.1 XendoU 330..590 CDD:286496 96/276 (35%)
si:dkey-222f8.3NP_001038432.1 XendoU 8..280 CDD:286496 96/276 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2849
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 1 1.000 - - otm25793
orthoMCL 1 0.900 - - OOG6_102937
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.680

Return to query results.
Submit another query.