DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2145 and endou2

DIOPT Version :9

Sequence 1:NP_001285102.1 Gene:CG2145 / 32027 FlyBaseID:FBgn0030251 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001018398.1 Gene:endou2 / 553584 ZFINID:ZDB-GENE-050522-373 Length:282 Species:Danio rerio


Alignment Length:273 Identity:98/273 - (35%)
Similarity:147/273 - (53%) Gaps:15/273 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 DDEIRQLTELLYTKESNSQIGNI--QVNLQGRTRSI----DSADEAPNPLLT-VDSKALESPTIV 387
            |.|:..|.:.|:..::|.....|  :::|||:...:    |.:|.|..||.: ||....:..|.:
Zfish     5 DRELSALIQELWDNDTNRLRPGIDYRISLQGKAGDLAGVPDDSDGAGMPLFSFVDENIFKKETFL 69

  Fly   388 KMRLLFNNYEHDTHVNEHVTPNERKEENDFLDAVMATPVMRQAMLFLQQKGVVSPDPKTHRDLVK 452
            ....|.:|||.||...|.|||.|..|.:.|||:|:.||.|:.|..:|.:|.:...|....:..:.
Zfish    70 AFISLLDNYESDTGEPEIVTPEEEMENHRFLDSVIKTPTMKIAHKYLVEKRLSPEDTTGFKQQLY 134

  Fly   453 ELWFTQYSR-GQGKIGSSGFEHVFVYEVKDG-TIIGFHNWVYIGDEEKDGRFDYKGYMKEQDIGT 515
            ::||..|:| |..|..|||||||||.|.:.| |:||||||:.:..:||.|..|||||....:...
Zfish   135 KIWFELYARKGSSKPDSSGFEHVFVGETRGGHTVIGFHNWIQLYLQEKLGHIDYKGYSVNANSPQ 199

  Fly   516 KGK---IVKIRFSHQGLNKPVNTVFVGTSPELELALYTVCFQLRPDRTCPVSLGNSKFGIVTYSW 577
            ..:   ::.::||.:...||..::|:|.|||.|.:|||:||.:.|:....||.......||.:  
Zfish   200 PDENKHMLALQFSWKNGIKPKGSIFIGVSPEFEFSLYTLCFLMSPNERVKVSFNLYDVEIVCH-- 262

  Fly   578 RYRGKNLIGSAYP 590
            .|..|: ||:.||
Zfish   263 HYNQKH-IGTTYP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2145NP_001285102.1 XendoU 330..590 CDD:286496 96/271 (35%)
endou2NP_001018398.1 XendoU 5..274 CDD:286496 96/271 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2849
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 1 1.000 - - mtm6587
orthoMCL 1 0.900 - - OOG6_102937
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.