DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2145 and Enpp3

DIOPT Version :9

Sequence 1:NP_001285102.1 Gene:CG2145 / 32027 FlyBaseID:FBgn0030251 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_062243.2 Gene:Enpp3 / 54410 RGDID:708511 Length:875 Species:Rattus norvegicus


Alignment Length:216 Identity:45/216 - (20%)
Similarity:62/216 - (28%) Gaps:80/216 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SPFGASQNPQTPPQWPSSTRATPSHPSQPSQPSQQPP-----LPGFASYRPQKPQPNSY-----D 166
            |.||.:..   .|.|.|.|  .|    :|...|..||     |.......|.:.|..|:     :
  Rat   632 SGFGKAMK---MPMWSSYT--VP----KPGDTSSLPPTVPDCLRADVRVDPSESQKCSFYLADQN 687

  Fly   167 LSYGGGPQPAPAGTGRPGFGLGISSTTSTTTTAKPITSTTGKTPQQKE-----DF---------- 216
            :.:|....||..|.....:...|               |:...|..||     |:          
  Rat   688 IDHGFLYPPAIKGNNESQYDALI---------------TSNLVPMYKEFKKMWDYFHKVLLIKYA 737

  Fly   217 ------PALPGP----------RRPSQKEDFPA---LPAPK------TPPGSPTPTPGSPSAWQS 256
                  ..:.||          ..|.:..::.|   :|.|.      |...:.|.||.|...|..
  Rat   738 IERNGVNVVSGPIFDYNYDGHFDAPDEITNYVAGTDVPVPTHYFVVLTSCKNKTHTPDSCPGWLD 802

  Fly   257 PLP--TPQHPVH----PPTKA 271
            .||  .|..|.:    |..||
  Rat   803 VLPFVVPHRPTNVESCPENKA 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2145NP_001285102.1 XendoU 330..590 CDD:286496
Enpp3NP_062243.2 SO 51..94 CDD:197571
Cell attachment site. /evidence=ECO:0000255 79..81
SO 95..138 CDD:197571
Phosphodiesterase 141..510
Phosphodiest 162..486 CDD:396300
Nuclease 605..875 45/216 (21%)
NUC 608..867 CDD:238043 45/216 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.