DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2145 and AT4G17100

DIOPT Version :9

Sequence 1:NP_001285102.1 Gene:CG2145 / 32027 FlyBaseID:FBgn0030251 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_193443.4 Gene:AT4G17100 / 3770328 AraportID:AT4G17100 Length:844 Species:Arabidopsis thaliana


Alignment Length:205 Identity:36/205 - (17%)
Similarity:67/205 - (32%) Gaps:72/205 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 KEENDFL---DAVMATPV--MRQAMLFLQQKGVVSPDPKTH------------------------ 447
            |:..||:   |.:::.||  :|:.:.....:.|:|..|..|                        
plant   521 KDLQDFMGGADIIVSDPVVSLRETVFERSCRTVMSKSPNKHNRLYMEARPMEDGLAEAIDEGRIG 585

  Fly   448 -------------------RDLVKELW-FTQYSRGQGKIGSSGFEHVFVYEVKDGTIIGFHNWVY 492
                               :||.|::| |...:.|...:........::.|:||..:.|| .|. 
plant   586 PSDDPKIRSKILAEEFGWDKDLAKKIWAFGPDTTGPNMVVDMCKGVQYLNEIKDSVVAGF-QWA- 648

  Fly   493 IGDEEKDGRF---DYKGYMKEQ-DIGTKGKIVKIRFSHQGLNKPVNTVFVGTSPELELALYTVCF 553
                .|:|..   :.:|...|. |:     ::.....|:|..:.::|.        ..|:|....
plant   649 ----SKEGPLAEENMRGVCYEVCDV-----VLHADAIHRGCGQMISTA--------RRAIYASQL 696

  Fly   554 QLRPDRTCPV 563
            ..:|....||
plant   697 TAKPRLLEPV 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2145NP_001285102.1 XendoU 330..590 CDD:286496 36/205 (18%)
AT4G17100NP_193443.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102937
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.760

Return to query results.
Submit another query.