DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2145 and endoul2

DIOPT Version :9

Sequence 1:NP_001285102.1 Gene:CG2145 / 32027 FlyBaseID:FBgn0030251 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_002933735.1 Gene:endoul2 / 100497154 XenbaseID:XB-GENE-5929403 Length:306 Species:Xenopus tropicalis


Alignment Length:288 Identity:96/288 - (33%)
Similarity:146/288 - (50%) Gaps:11/288 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 TVRPGFQSSGNSVATDDEIRQLTELLYTKESN-SQIGNIQVNLQGR---TRSIDSADEAPNPLLT 375
            ::.|..:.:..:.||:.||:.|.|..|..::| :..|:|.:|||.:   ::|....|.|...|.:
 Frog    20 SILPEPRKNVRASATNAEIQSLAEQFYAADTNKAASGDINLNLQYKATSSQSTSGTDYASQKLFS 84

  Fly   376 V--DSKALESPTIVKMRLLFNNYEHDTHVNEHVTPNERKEENDFLDAVMATPVMRQAMLFLQQKG 438
            .  ::|....||..|:..|.:||...|...|.|...|.:|:|.|:|.:..|.::.:...|...||
 Frog    85 YVNEAKLFARPTFAKLVALLDNYVQITGTAESVPTAEVQEQNAFIDEIFKTSIITKLSNFFISKG 149

  Fly   439 VVSPDPKTHRDLVKELWFTQYSRGQGKIGSSGFEHVFVYEVKDGTIIGFHNWVYIGDEEKDGRFD 503
            ..|.......|| ||:||..|:|..|.:.||||||||..|:..|.|.|.|:||.:...||.|:.:
 Frog   150 YYSTAASFKTDL-KEMWFGLYTRTSGPLDSSGFEHVFHGEIHKGKISGLHSWVQLYLLEKSGQVN 213

  Fly   504 YKGYMKEQDIGTKGKIVKIRFSHQGLNKPVNTVFVGTSPELELALYTVCFQLRPDRTCPVSLGNS 568
            |..|..:........:...:.......|.:.:.|||:|||.::|:||:|:..|||..|.|.:|.|
 Frog   214 YLSYTSDGVWTGYPDVYAFQLKWNTYLKTIGSFFVGSSPEFDIAMYTLCYVTRPDSLCTVQMGGS 278

  Fly   569 KFGIVTYSWRY----RGKNLIGSAYPEI 592
            .|.|.||:|..    .||..:.|:||.|
 Frog   279 TFQIQTYTWANSTYGNGKRYVASSYPNI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2145NP_001285102.1 XendoU 330..590 CDD:286496 90/269 (33%)
endoul2XP_002933735.1 XendoU 35..304 CDD:370473 90/269 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4133
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D596408at33208
OrthoFinder 1 1.000 - - FOG0003014
OrthoInspector 1 1.000 - - otm49245
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2515
SonicParanoid 1 1.000 - - X4814
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.