DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43901 and LRG1

DIOPT Version :9

Sequence 1:NP_001096948.2 Gene:CG43901 / 32024 FlyBaseID:FBgn0264502 Length:2281 Species:Drosophila melanogaster
Sequence 2:NP_010041.2 Gene:LRG1 / 851358 SGDID:S000002399 Length:1017 Species:Saccharomyces cerevisiae


Alignment Length:336 Identity:71/336 - (21%)
Similarity:130/336 - (38%) Gaps:58/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1349 STSASVSATEQQQFEAQKPPPIPPKET---SPTQISGILKGGKLWKQDSISQQQSDDQNNTTSED 1410
            |...||..|..:| :|:|...:...||   .||: .|..|...:...|..|.||...:.|..|..
Yeast   545 SRRESVRVTHNKQ-QARKSVILETAETDLNDPTK-QGDSKNLVIQTDDPSSSQQVSTRENVFSNT 607

  Fly  1411 ESGGTKRSVRFVTEDQANAGTDSDAQSLAGDLDDSENQINELIPIKK---HSTLFNNALRPNSAV 1472
            ::.......|.|..:||.. ...:|.:....|.:::::.:.::|.|.   :|.|....|   |.:
Yeast   608 KTLTLDDISRIVAAEQARE-LRPNAFAHFKKLKETDDETSNVVPKKSGVYYSELSTMEL---SMI 668

  Fly  1473 RQLFPSVSAHQA------PVLTSEALRAFDESKRAGCLVTHLPGSCGDSDTLRRSME-RNILRRS 1530
            |.:..|:.|.:.      |..||.....|...|:       :.||..:...:..||| :..:.::
Yeast   669 RAISLSLLAGKQLISKTDPNYTSLVSMVFSNEKQ-------VTGSFWNRMKIMMSMEPKKPITKT 726

  Fly  1531 --------LIKKKAVKSDISLEERIKQLTCDIDEDLAEELQRAVDEDAESVAERADELAQ-RNSP 1586
                    |.:|..|.||:.:.....::...||| |...| |.:|...|.:..:...:.: |...
Yeast   727 VFGAPLDVLCEKWGVDSDLGVGPVKIRIPIIIDE-LISSL-RQMDMSVEGIFRKNGNIRRLRELT 789

  Fly  1587 AG-EENPNPVPGSGQAHKFVNGEKSFSPSSSVSSSSSGSSAYKKI------ADIFNRDKKQEKI- 1643
            |. :.||...|             .||..:::..|:......:::      .|::....|..|| 
Yeast   790 ANIDSNPTEAP-------------DFSKENAIQLSALLKKFIRELPQPILSTDLYELWIKAAKID 841

  Fly  1644 MEMEENPIVII 1654
            :|.|:..::::
Yeast   842 LEDEKQRVILL 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43901NP_001096948.2 None
LRG1NP_010041.2 LIM1_Lrg1p_like 28..90 CDD:188777
LIM 98..149 CDD:259829
LIM3_Lrg1p_like 419..475 CDD:188779
RhoGAP_fLRG1 728..959 CDD:239862 27/140 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24215
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.