DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43901 and Mlp84B

DIOPT Version :9

Sequence 1:NP_001096948.2 Gene:CG43901 / 32024 FlyBaseID:FBgn0264502 Length:2281 Species:Drosophila melanogaster
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:255 Identity:52/255 - (20%)
Similarity:78/255 - (30%) Gaps:93/255 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1362 FEAQKPPPIPPKETSPTQISGILKGGKLWKQD----SISQQQSDDQNNTTSEDE-----SGGTK- 1416
            |:..:.|..|....|.......|.||.::.::    .:..:..|..|.|..|.|     ..|.| 
  Fly     4 FQPIEAPKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKF 68

  Fly  1417 --RSVRFVTEDQANAGT---DSDAQSLA--GDLDDSENQINELIPIKKHSTLFNNALRPNSAVRQ 1474
              :...|.|    .|||   |:.:|.|.  ||:....|               ...|.|.:..| 
  Fly    69 GPKGYGFGT----GAGTLSMDNGSQFLRENGDVPSVRN---------------GARLEPRAIAR- 113

  Fly  1475 LFPSVSAHQAP-----------VLTSEALRAFDESKRAGCLVTHLPGSCG------DSDTLRRSM 1522
                     ||           |..:|.:.|...|....|.      .||      ||.....:.
  Fly   114 ---------APEGEGCPRCGGYVYAAEQMLARGRSWHKECF------KCGTCKKGLDSILCCEAP 163

  Fly  1523 ERNILRRSLIKKK-------------AVKSDISLEERIKQLTCDIDEDLAEELQRAVDED 1569
            ::||..:....||             |::||           |...:|.|.:::.|:|.|
  Fly   164 DKNIYCKGCYAKKFGPKGYGYGQGGGALQSD-----------CYAHDDGAPQIRAAIDVD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43901NP_001096948.2 None
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 10/52 (19%)
LIM_CRP_like 120..173 CDD:188712 11/58 (19%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24215
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.