DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15208 and ANP32E

DIOPT Version :9

Sequence 1:NP_001285099.1 Gene:CG15208 / 32022 FlyBaseID:FBgn0030247 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_005245570.1 Gene:ANP32E / 81611 HGNCID:16673 Length:286 Species:Homo sapiens


Alignment Length:157 Identity:45/157 - (28%)
Similarity:71/157 - (45%) Gaps:30/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKQLTEHMVESMSRCRDYAKALKLNFCNC------GLNDISL---CLKMPYLEVLSL----SMN 52
            |:|::.   :|..:|..:....|.|:.|.|      ||||...   .|.|..:|:.||    |:|
Human     3 MKKKIN---LELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLN 64

  Fly    53 KITSLK---SLV---------RCTRLKELYLRQNEIADFDELKYLVNAKSLTSLWLLDNPCSIAA 105
            |:..|:   :::         :|..|..|.|..|:|.|...::.|.|.|:|.||.|.:  |.|..
Human    65 KLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFN--CEITN 127

  Fly   106 GSNYRASVLRMLPNLKKLDNVDVAEEE 132
            ..:||.|:..:|..:..||..|..:.|
Human   128 LEDYRESIFELLQQITYLDGFDQEDNE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15208NP_001285099.1 LRR_4 42..83 CDD:289563 14/56 (25%)
leucine-rich repeat 44..65 CDD:275382 8/36 (22%)
leucine-rich repeat 66..89 CDD:275382 8/22 (36%)
leucine-rich repeat 91..119 CDD:275382 10/27 (37%)
ANP32EXP_005245570.1 leucine-rich repeat 44..65 CDD:275380 6/20 (30%)
AMN1 <53..>126 CDD:187754 22/74 (30%)
LRR_8 65..125 CDD:290566 17/61 (28%)
leucine-rich repeat 66..89 CDD:275380 2/22 (9%)
leucine-rich repeat 90..114 CDD:275380 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.