DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15208 and lrrc9

DIOPT Version :10

Sequence 1:NP_572664.1 Gene:CG15208 / 32022 FlyBaseID:FBgn0030247 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_017951824.1 Gene:lrrc9 / 780204 XenbaseID:XB-GENE-1011352 Length:1514 Species:Xenopus tropicalis


Alignment Length:305 Identity:72/305 - (23%)
Similarity:122/305 - (40%) Gaps:87/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKQLTE-HM--VESMSRCRDYAKALKLNFCNCGLNDISL------CLKMPYLEVLSLSMNKITSL 57
            |..:|| |:  ::.:..|.|..|....:      |:||:      .||   ||||.|:.|:|..:
 Frog    80 ELWITECHLSKIQGLHHCADLQKLYLYH------NEISVIEGLENLLK---LEVLWLNNNQINVI 135

  Fly    58 KSLVRCTRLKELYLRQ-----------------------NEIADFDELKYLVNAKSLTSLWLLD- 98
            :.|.....||||.|..                       |:|:.|.||..|....||..|.|.| 
 Frog   136 EGLDMMQNLKELNLANNLIHSIGESLDPNVQLERLNLSGNKISSFKELTNLARLPSLMDLGLKDP 200

  Fly    99 --NPCSIAAGSNYRASVLRMLPNLKKLDNVDVAEEELESALRYDYYPDVGSAILNPVLDLSNCSP 161
              :|..:....||...||..:|.|::||..||:|:::::...        |.::..:        
 Frog   201 QYSPNPVCLLCNYAIHVLYHIPQLQRLDTYDVSEKQIKNLAE--------STVVKKI-------- 249

  Fly   162 DDMAYRDMIEQCDRTIRQVQQQQRKRFASGDAKNIDELARIRSRSVLVNG--------------- 211
              |.|...::...|..|:..::.|:|  :..||.:.| .|||:.|.||..               
 Frog   250 --MYYNMRMKNNQRQQREELEKVRER--TSKAKQVPE-NRIRALSFLVKNLEHELTDMQSSGNMQ 309

  Fly   212 ERLPLF--FPSDLRQVRQAQKAQDALRKQKNQPIWHNEQVQQAHK 254
            ..:|:.  |..:.....::...|.:.|::.|     :::::|.||
 Frog   310 ANIPISNKFHENNCDTEESNSQQSSERRKNN-----SDRLEQIHK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15208NP_572664.1 PPP1R42 <44..132 CDD:455733 36/113 (32%)
leucine-rich repeat 44..65 CDD:275382 8/20 (40%)
leucine-rich repeat 66..89 CDD:275382 11/45 (24%)
leucine-rich repeat 91..119 CDD:275382 9/30 (30%)
lrrc9XP_017951824.1 PPP1R42 46..243 CDD:455733 48/179 (27%)
leucine-rich repeat 56..77 CDD:275380
leucine-rich repeat 78..99 CDD:275380 5/18 (28%)
leucine-rich repeat 100..121 CDD:275380 4/26 (15%)
leucine-rich repeat 122..143 CDD:275380 8/20 (40%)
leucine-rich repeat 144..166 CDD:275380 5/21 (24%)
LRR 622..1059 CDD:443914
leucine-rich repeat 703..723 CDD:275380
leucine-rich repeat 724..745 CDD:275380
leucine-rich repeat 746..767 CDD:275380
leucine-rich repeat 768..794 CDD:275380
leucine-rich repeat 795..821 CDD:275380
leucine-rich repeat 822..918 CDD:275380
PPP1R42 892..1074 CDD:455733
leucine-rich repeat 919..940 CDD:275380
leucine-rich repeat 941..962 CDD:275380
leucine-rich repeat 963..986 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
PPP1R42 1103..1369 CDD:455733
leucine-rich repeat 1127..1148 CDD:275380
leucine-rich repeat 1149..1174 CDD:275380
leucine-rich repeat 1175..1211 CDD:275380
leucine-rich repeat 1212..1235 CDD:275380
leucine-rich repeat 1236..1257 CDD:275380
leucine-rich repeat 1258..1281 CDD:275380
leucine-rich repeat 1282..1305 CDD:275380
leucine-rich repeat 1306..1328 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.