DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15208 and anp32a

DIOPT Version :9

Sequence 1:NP_001285099.1 Gene:CG15208 / 32022 FlyBaseID:FBgn0030247 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001016746.1 Gene:anp32a / 549500 XenbaseID:XB-GENE-982550 Length:244 Species:Xenopus tropicalis


Alignment Length:238 Identity:59/238 - (24%)
Similarity:94/238 - (39%) Gaps:52/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKQLTEHMVESMSRCRDYAKALKLNFCNC------GLND----------ISLCL-------KMP 42
            |:|::  |: |..:|.....|.|.|:.|..      ||.|          |::||       |:.
 Frog     3 MKKRI--HL-ELRNRTPADVKELVLDNCRSKEGKIEGLTDEFEGLEFLSTINVCLSSIANLPKLN 64

  Fly    43 YLEVLSLSMNKIT-SLKSLV-RCTRLKELYLRQNEIADFDELKYLVNAKSLTSLWLLDNPCSIAA 105
            .|:.|.||.|.|: .|:.|. :|..|..|.|..|.|.|...::.|...:.|.||.|.:  |.:..
 Frog    65 KLKKLELSDNNISGGLEVLAEKCPNLTHLNLSGNRIKDLSTIEPLKKLEHLKSLDLFN--CEVTN 127

  Fly   106 GSNYRASVLRMLPNLKKLDNVDVAEEELESALRYDYYPDVGSAILNPVLDLSNCSPDDMAY---- 166
            .::||.:|.::||.|..||..|..::|.         ||..:......||..:...|:..|    
 Frog   128 LNDYRENVFKLLPQLTYLDGYDRDDKEA---------PDSDAEGYVEGLDDDDDEEDEDDYDEDA 183

  Fly   167 ---------RDMIEQCDRTIRQVQQQQRKRFASGDAKNIDELA 200
                     .|..|..:..:...:::....:..|:....||.|
 Frog   184 PPGEEGEDDEDEEEGEEEEVSGEEEEDEDAYREGEEDEADEEA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15208NP_001285099.1 LRR_4 42..83 CDD:289563 15/42 (36%)
leucine-rich repeat 44..65 CDD:275382 9/22 (41%)
leucine-rich repeat 66..89 CDD:275382 7/22 (32%)
leucine-rich repeat 91..119 CDD:275382 9/27 (33%)
anp32aNP_001016746.1 LRR_9 <71..146 CDD:373143 25/76 (33%)
leucine-rich repeat 90..114 CDD:275380 7/23 (30%)
leucine-rich repeat 115..141 CDD:275380 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.