DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15208 and Mapmodulin

DIOPT Version :9

Sequence 1:NP_001285099.1 Gene:CG15208 / 32022 FlyBaseID:FBgn0030247 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001097361.1 Gene:Mapmodulin / 37043 FlyBaseID:FBgn0034282 Length:363 Species:Drosophila melanogaster


Alignment Length:217 Identity:62/217 - (28%)
Similarity:99/217 - (45%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEHMVESMSRCR---------DYAKALKLNFCNCGLNDISLCLKMPYLEVLSLSMNKITS-LK 58
            |:||   .::..||         :|.....|:..|.||..:....|:|.|:.|.||.|:|:| |.
  Fly    16 QITE---LNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLN 77

  Fly    59 SLVRCTRLKELYLRQNEIADFDELKYLVNAKSLTSLWLLDNPCSIAAGSNYRASVLRMLPNLKKL 123
            .|....:|:.|.|..|:|.|.:.||.|...|:|..|.|.:|..:..  .|||..:.:|||:|..|
  Fly    78 YLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQV--DNYREKIFKMLPSLNFL 140

  Fly   124 DNVDVAEEELES------ALRYDYYPDVG----SAILNPV-LDLSNCSPDDMAYRDMIEQCDRTI 177
            |..|..:||::|      .:..:...:||    :..||.: :||           |.:|..::.:
  Fly   141 DGFDCNDEEVQSDGDDDDEVNGNDSDEVGDKCNAFCLNGLEIDL-----------DELEAFEKRV 194

  Fly   178 RQVQQQQRKRFASGDAKNIDEL 199
            :..:..|.|.....:.|.:|||
  Fly   195 KAKKSLQDKPPPQSEDKEVDEL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15208NP_001285099.1 LRR_4 42..83 CDD:289563 16/41 (39%)
leucine-rich repeat 44..65 CDD:275382 9/21 (43%)
leucine-rich repeat 66..89 CDD:275382 9/22 (41%)
leucine-rich repeat 91..119 CDD:275382 9/27 (33%)
MapmodulinNP_001097361.1 leucine-rich repeat 17..39 CDD:275380 5/24 (21%)
LRR_4 38..74 CDD:289563 12/35 (34%)
LRR_8 40..95 CDD:290566 19/54 (35%)
leucine-rich repeat 40..61 CDD:275380 5/20 (25%)
LRR_4 60..103 CDD:289563 17/42 (40%)
leucine-rich repeat 62..84 CDD:275380 9/21 (43%)
LRR_4 83..125 CDD:289563 14/43 (33%)
leucine-rich repeat 85..109 CDD:275380 9/23 (39%)
leucine-rich repeat 110..136 CDD:275380 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.