DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15208 and T19H12.2

DIOPT Version :10

Sequence 1:NP_572664.1 Gene:CG15208 / 32022 FlyBaseID:FBgn0030247 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_504310.2 Gene:T19H12.2 / 178881 WormBaseID:WBGene00020588 Length:228 Species:Caenorhabditis elegans


Alignment Length:116 Identity:38/116 - (32%)
Similarity:58/116 - (50%) Gaps:10/116 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LNFCNCGLNDISLCLKMPYLEVLSLSMNKI---TSLKSLVRCT-RLKELYLRQNEIADFDELKYL 85
            |:...|||..:.....:|.|..|.||.|::   .|...|::|. .:|::.|..|.:. .|.::.|
 Worm    46 LSMVKCGLTTLKGMPVLPALNYLDLSDNELGDDASFDVLIKCAPEIKKITLSGNRLT-LDNVRTL 109

  Fly    86 VNAKSLTSLWLLD--NPCSIAAGSNYRASVLRMLPNLKKLDNVDVAEEELE 134
               |.|.:|..||  |..|:....:||..:..|:|:||.||..||..||:|
 Worm   110 ---KMLPNLMELDLSNNSSLGLLDDYRVKMFEMIPSLKILDGCDVDGEEVE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15208NP_572664.1 PPP1R42 <44..132 CDD:455733 30/93 (32%)
leucine-rich repeat 44..65 CDD:275382 8/24 (33%)
leucine-rich repeat 66..89 CDD:275382 5/22 (23%)
leucine-rich repeat 91..119 CDD:275382 9/29 (31%)
T19H12.2NP_504310.2 leucine-rich repeat 22..42 CDD:275378
PPP1R42 <43..151 CDD:455733 33/108 (31%)
leucine-rich repeat 43..64 CDD:275378 4/17 (24%)
leucine-rich repeat 65..90 CDD:275378 8/24 (33%)
leucine-rich repeat 91..114 CDD:275378 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.