DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15208 and T19H12.2

DIOPT Version :9

Sequence 1:	NP_001285099.1	Gene:	CG15208 / 32022	FlyBaseID:	FBgn0030247	Length:	365	Species:	Drosophila melanogaster
Sequence 2:	NP_504310.2	Gene:	T19H12.2 / 178881	WormBaseID:	WBGene00020588	Length:	228	Species:	Caenorhabditis elegans

Alignment Length:	116	Identity:	38/116 - (32%)
Similarity:	58/116 - (50%)	Gaps:	10/116 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    25 LNFCNCGLNDISLCLKMPYLEVLSLSMNKI---TSLKSLVRCT-RLKELYLRQNEIADFDELKYL 85
            |:...|||..:.....:|.|..|.||.|::   .|...|::|. .:|::.|..|.:. .|.::.|
Worm    46 LSMVKCGLTTLKGMPVLPALNYLDLSDNELGDDASFDVLIKCAPEIKKITLSGNRLT-LDNVRTL 109

  Fly    86 VNAKSLTSLWLLD--NPCSIAAGSNYRASVLRMLPNLKKLDNVDVAEEELE 134
               |.|.:|..||  |..|:....:||..:..|:|:||.||..||..||:|
Worm   110 ---KMLPNLMELDLSNNSSLGLLDDYRVKMFEMIPSLKILDGCDVDGEEVE 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15208	NP_001285099.1	LRR_4	42..83	CDD:289563	13/44 (30%)
		leucine-rich repeat	44..65	CDD:275382	8/24 (33%)
		leucine-rich repeat	66..89	CDD:275382	5/22 (23%)
		leucine-rich repeat	91..119	CDD:275382	9/29 (31%)
T19H12.2	NP_504310.2	LRR	<22..>129	CDD:227223	25/86 (29%)
		leucine-rich repeat	22..42	CDD:275378
		leucine-rich repeat	43..64	CDD:275378	4/17 (24%)
		leucine-rich repeat	65..90	CDD:275378	8/24 (33%)
		leucine-rich repeat	91..114	CDD:275378	7/26 (27%)
		LRR_8	92..147	CDD:338972	18/58 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910