DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15208 and Anp32b

DIOPT Version :9

Sequence 1:NP_001285099.1 Gene:CG15208 / 32022 FlyBaseID:FBgn0030247 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_571986.1 Gene:Anp32b / 170724 RGDID:621285 Length:272 Species:Rattus norvegicus


Alignment Length:179 Identity:47/179 - (26%)
Similarity:69/179 - (38%) Gaps:34/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LNFCNCGLNDISLCLKMPYLEVLSLSMNKI-TSLKSLV-RCTRLKELYLRQNEIADFDELKYLVN 87
            |:..|.||..:|...|:|.|:.|.||.|:| ..|..|. ....|..|.|..|.:.|...|:.|..
  Rat    47 LSLINVGLFSVSDLPKLPKLKKLELSENRIFGGLDRLAEELPSLTHLNLSGNNLKDISTLEPLKR 111

  Fly    88 AKSLTSLWLLDNPCSIAAGSNYRASVLRMLPNLKKLDNVDVAEEELESALRYDYYPDVGSAILNP 152
            ...|.||.|..  |.:...|:||.:|.|:||.|..||..|..::|                    
  Rat   112 LDCLKSLDLFG--CEVTNRSDYRETVFRLLPQLSYLDGYDREDQE-------------------- 154

  Fly   153 VLDLSNCSPDDMAYRDMIEQC---DRTIRQVQQQQRKRFASGDAKNIDE 198
                   :||.....|.:|:.   |..:..|.:::.......:.:..||
  Rat   155 -------APDSDVEVDSVEEAPDSDGEVDGVDKEEEDEEGEDEEEEEDE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15208NP_001285099.1 LRR_4 42..83 CDD:289563 14/42 (33%)
leucine-rich repeat 44..65 CDD:275382 8/22 (36%)
leucine-rich repeat 66..89 CDD:275382 7/22 (32%)
leucine-rich repeat 91..119 CDD:275382 11/27 (41%)
Anp32bNP_571986.1 LRR <16..>115 CDD:227223 22/67 (33%)
LRR 1 16..40
leucine-rich repeat 19..43 CDD:275380
LRR 2 43..64 6/16 (38%)
leucine-rich repeat 44..67 CDD:275380 7/19 (37%)
LRR 3 65..84 7/18 (39%)
LRR_9 <71..146 CDD:405295 26/76 (34%)
LRR 4 89..110 6/20 (30%)
leucine-rich repeat 90..113 CDD:275382 7/22 (32%)
leucine-rich repeat 115..141 CDD:275382 11/27 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..272 10/75 (13%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q92688 260..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.