DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1582 and DHX40

DIOPT Version :10

Sequence 1:NP_572663.1 Gene:CG1582 / 32021 FlyBaseID:FBgn0030246 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_078888.4 Gene:DHX40 / 79665 HGNCID:18018 Length:779 Species:Homo sapiens


Alignment Length:49 Identity:17/49 - (34%)
Similarity:24/49 - (48%) Gaps:9/49 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ITGSGSGIGRLMALEFA---KLGAEVVI----WDVNKDGAEETKNQVVK 85
            :..:.||.|.|  ||||   .|.:.|:.    ||...||.||.:.:.:|
Human    86 VPSAPSGPGPL--LEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1582NP_572663.1 UBA_like_SF 123..154 CDD:473871
RWD_DHX57 175..367 CDD:467661
zf-CCCH 245..272 CDD:459885
HrpA 452..>1075 CDD:441249
OB_NTP_bind 1114..1212 CDD:400182
DHX40NP_078888.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
HrpA 51..>724 CDD:441249 17/49 (35%)
DEAH box 173..176
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 737..779
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.