powered by:
Protein Alignment CG1582 and T07D4.5
DIOPT Version :9
Sequence 1: | NP_001285098.1 |
Gene: | CG1582 / 32021 |
FlyBaseID: | FBgn0030246 |
Length: | 1288 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122634.1 |
Gene: | T07D4.5 / 6418633 |
WormBaseID: | WBGene00045407 |
Length: | 142 |
Species: | Caenorhabditis elegans |
Alignment Length: | 64 |
Identity: | 16/64 - (25%) |
Similarity: | 33/64 - (51%) |
Gaps: | 7/64 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 647 FLEDILEMSDFVMEYDTKYCRKLKKQEQEILERELE-------YADVQASGEAPGKKIKDEKLT 703
||:.....|..::|.|||...:::.|.||::::::: ..:::..|......:||.|||
Worm 78 FLQTSQANSLNILEKDTKTVEEVRGQIQEVIKKDMDTFLKLHKKRNLEERGFGLKPLLKDGKLT 141
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1643 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.