DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1582 and T07D4.5

DIOPT Version :9

Sequence 1:NP_001285098.1 Gene:CG1582 / 32021 FlyBaseID:FBgn0030246 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_001122634.1 Gene:T07D4.5 / 6418633 WormBaseID:WBGene00045407 Length:142 Species:Caenorhabditis elegans


Alignment Length:64 Identity:16/64 - (25%)
Similarity:33/64 - (51%) Gaps:7/64 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   647 FLEDILEMSDFVMEYDTKYCRKLKKQEQEILERELE-------YADVQASGEAPGKKIKDEKLT 703
            ||:.....|..::|.|||...:::.|.||:::::::       ..:::..|......:||.|||
 Worm    78 FLQTSQANSLNILEKDTKTVEEVRGQIQEVIKKDMDTFLKLHKKRNLEERGFGLKPLLKDGKLT 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1582NP_001285098.1 UBA_like_SF 123..154 CDD:304366
zf-CCCH 250..272 CDD:279036
RWD <284..360 CDD:283440
HrpA 419..1206 CDD:224557 16/64 (25%)
DEXDc 471..619 CDD:238005
HELICc 781..871 CDD:197757
HA2 948..1029 CDD:214852
OB_NTP_bind 1070..1212 CDD:285018
T07D4.5NP_001122634.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.