DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1582 and zcchc17

DIOPT Version :9

Sequence 1:NP_001285098.1 Gene:CG1582 / 32021 FlyBaseID:FBgn0030246 Length:1288 Species:Drosophila melanogaster
Sequence 2:NP_956838.2 Gene:zcchc17 / 393516 ZFINID:ZDB-GENE-040325-2 Length:235 Species:Danio rerio


Alignment Length:178 Identity:39/178 - (21%)
Similarity:64/178 - (35%) Gaps:63/178 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 EAALLLLYRRYMRIPDEEQLTLEPPSEQ---------EILD-------------MRADEKE---A 187
            |...:..|..:::||...:..|...||.         ||:|             |:.|:.:   :
Zfish    25 EVVSVTAYGAFVKIPGYRKQGLVHKSEMSACRVENPAEIVDVGEQVWIKVIGKEMKDDKVKLSFS 89

  Fly   188 LESIFDKAYEEREANRV-------WNLKFRIDHLLAHSPSEVRKAREAVLAAAAAAAQAALDKKK 245
            ::|:......:.:.|.|       ...:|| ||      |..|...||||....          |
Zfish    90 MKSVNQGTGRDLDPNNVIAEQDERRRRQFR-DH------SGQRITLEAVLNTTC----------K 137

  Fly   246 KPPLRCR-NFDRDGTCKYGPKCRFAHLPQ---------QPTESDTTKK 283
            |  ..|| :|.:|  |...|..:::.||:         |.|:|:..|:
Zfish   138 K--CGCRGHFAKD--CFSSPGLQYSLLPEEEEEEPLSTQITQSEPQKR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1582NP_001285098.1 UBA_like_SF 123..154 CDD:304366 1/5 (20%)
zf-CCCH 250..272 CDD:279036 6/22 (27%)
RWD <284..360 CDD:283440 39/178 (22%)
HrpA 419..1206 CDD:224557
DEXDc 471..619 CDD:238005
HELICc 781..871 CDD:197757
HA2 948..1029 CDD:214852
OB_NTP_bind 1070..1212 CDD:285018
zcchc17NP_956838.2 S1_pNO40 16..89 CDD:240191 12/63 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.