DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and CG42594

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster


Alignment Length:266 Identity:50/266 - (18%)
Similarity:93/266 - (34%) Gaps:104/266 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNGILFAGLGEYFGRTFEAI 151
            |:.|.|..||.::.||.:|:||||::|.|..||::.:||:..|||:..:..:..|....|....:
  Fly   597 PHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREV 661

  Fly   152 Y--------------------------RRYKKYKMSTDM----------HYV------------- 167
            :                          ||.::.:...::          :||             
  Fly   662 FSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAG 726

  Fly   168 ----PPQLG---------------------------LITTVVIALIPGIALFLLLPSWVFTYFEN 201
                ||..|                           .|...::.....:.::::..:.|....|.
  Fly   727 AGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEK 791

  Fly   202 WPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWF----------------------VVYQI 244
            ||....:|:.:::.:||||||.:|  |..:......||                      :|::|
  Fly   792 WPILDGIYFCFMSLSTIGFGDMLP--GLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEEIVHRI 854

  Fly   245 FVIVWF 250
            .::|.|
  Fly   855 RIVVEF 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 21/53 (40%)
Ion_trans_2 185..269 CDD:285168 19/88 (22%)
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 21/56 (38%)
Ion_trans <601..640 CDD:278921 16/38 (42%)
Ion_trans_2 774..846 CDD:285168 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461328
Domainoid 1 1.000 56 1.000 Domainoid score I2685
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.