Sequence 1: | NP_001285097.1 | Gene: | Ork1 / 32020 | FlyBaseID: | FBgn0017561 | Length: | 1019 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001162668.2 | Gene: | CG42594 / 8674091 | FlyBaseID: | FBgn0260971 | Length: | 1039 | Species: | Drosophila melanogaster |
Alignment Length: | 266 | Identity: | 50/266 - (18%) |
---|---|---|---|
Similarity: | 93/266 - (34%) | Gaps: | 104/266 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 PYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNGILFAGLGEYFGRTFEAI 151
Fly 152 Y--------------------------RRYKKYKMSTDM----------HYV------------- 167
Fly 168 ----PPQLG---------------------------LITTVVIALIPGIALFLLLPSWVFTYFEN 201
Fly 202 WPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWF----------------------VVYQI 244
Fly 245 FVIVWF 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ork1 | NP_001285097.1 | Ion_trans_2 | <90..144 | CDD:285168 | 21/53 (40%) |
Ion_trans_2 | 185..269 | CDD:285168 | 19/88 (22%) | ||
CG42594 | NP_001162668.2 | Ion_trans_2 | <599..656 | CDD:285168 | 21/56 (38%) |
Ion_trans | <601..640 | CDD:278921 | 16/38 (42%) | ||
Ion_trans_2 | 774..846 | CDD:285168 | 15/73 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45461328 | |
Domainoid | 1 | 1.000 | 56 | 1.000 | Domainoid score | I2685 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D774951at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR11003 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.950 |