DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNK16

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001128577.1 Gene:KCNK16 / 83795 HGNCID:14464 Length:322 Species:Homo sapiens


Alignment Length:226 Identity:77/226 - (34%)
Similarity:117/226 - (51%) Gaps:25/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGD-KNTTTQD----- 63
            |.:.||:.|:.||:.||.|:..:|...|..||          :::.||:|.. :|.|..|     
Human    13 RVLPLLLAYVCYLLLGATIFQLLERQAEAQSR----------DQFQLEKLRFLENYTCLDQWAME 67

  Fly    64 EILQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVI 128
            :.:|.|.:...|.|. |......|..|.|..:||||.||.:|:||||::|:|.||::..:.|:::
Human    68 QFVQVIMEAWVKGVN-PKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALL 131

  Fly   129 GIPVNGILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIPGIALFLLLPS 193
            |||:|.|....||........||.|...:.:.|    .|...|||    .:.|..|..:.|:.|.
Human   132 GIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRS----QVLQVLGL----ALFLTLGTLVILIFPP 188

  Fly   194 WVFTYFENWPYSISLYYSYVTTTTIGFGDYV 224
            .||::.|.|.:|...|::::|.:||||||||
Human   189 MVFSHVEGWSFSEGFYFAFITLSTIGFGDYV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 25/53 (47%)
Ion_trans_2 185..269 CDD:285168 17/40 (43%)
KCNK16NP_001128577.1 Ion_trans_2 <92..148 CDD:311712 25/55 (45%)
Ion_trans_2 180..>224 CDD:311712 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155184
Domainoid 1 1.000 65 1.000 Domainoid score I10023
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm41289
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.