DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCO1

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:240 Identity:55/240 - (22%)
Similarity:101/240 - (42%) Gaps:35/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 AFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNGILFAGLGEYFGRTFEAIYRRYKKYK 159
            |.:|.....:|||||::.|.:.|.|::..|:...|:.:.|.|.:...:|.....||:..|....:
plant   112 ALYFCIVTMTTVGYGDLVPNSSASRLLACAFVFSGMVLVGHLLSRAADYLVEKQEALLVRAFHLR 176

  Fly   160 MS---TD----MHYVPPQLGLITT---VVIALIPGIALFLLLPSWVFTYFENWPYSISLYYSYVT 214
            .|   ||    :|....:.....|   :|:..|.| .:||::       .|..|...:.|....|
plant   177 QSFGPTDILKELHTNKLRYKCYATCLVLVVLFIVG-TIFLVM-------VEKMPVISAFYCVCST 233

  Fly   215 TTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWFIFSLGYLVMIMTFITR-GLQSKKLAYLEQ 278
            .||:|:||  .:|.:    |.|      ::|.:.|.:.|...|.....::.. ..::|:.|.::.
plant   234 VTTLGYGD--KSFNS----EAG------RLFAVFWILTSSICLAQFFLYVAELNTENKQRALVKW 286

  Fly   279 QLSSNLKATQNRIWSGVTKDVGYLRRMLNELYILKVKFCRKGNRK 323
            .|:..:  |.|.:.:....:.|.:...  |..:.|:|...|.:.|
plant   287 VLTRRI--TNNDLEAADLDEDGVVGAA--EFIVYKLKEMGKIDEK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 14/48 (29%)
Ion_trans_2 185..269 CDD:285168 18/84 (21%)
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:400301 15/50 (30%)
Ion_trans_2 202..277 CDD:400301 21/94 (22%)
FRQ1 <235..353 CDD:227455 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.