DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCO2

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_199449.1 Gene:KCO2 / 834680 AraportID:AT5G46370 Length:443 Species:Arabidopsis thaliana


Alignment Length:150 Identity:36/150 - (24%)
Similarity:65/150 - (43%) Gaps:35/150 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 AFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNGILFAGLGEYF-----------GRTF 148
            |.:|......|:|||:|:|.:...::..|.:.::|.....||.:|:..|.           .|. 
plant   182 ALYFCIVTMCTIGYGDITPDSVVTKLFSIFFVLVGFGFMDILLSGMVTYVLDLQENYMLETARN- 245

  Fly   149 EAI-------YRRY----KKYKMSTDMHYVPPQLGLITTVVIALIPGIALFLLLPSWVFTYFENW 202
            |::       .|.|    ||.:|...:     ::||...||: |..|..:.::      .:.|..
plant   246 ESLNLNDRDKVRSYIIDVKKGRMRIRL-----KVGLALGVVV-LCLGFGVLIM------HFVEKI 298

  Fly   203 PYSISLYYSYVTTTTIGFGD 222
            .:..|.|:|.::.||:|:||
plant   299 GWLDSFYFSVMSVTTVGYGD 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 13/48 (27%)
Ion_trans_2 185..269 CDD:285168 8/37 (22%)
KCO2NP_199449.1 Ion_trans_2 152..233 CDD:400301 14/50 (28%)
Ion_trans_2 280..350 CDD:400301 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.