DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and kcnk1a

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001092223.1 Gene:kcnk1a / 793480 ZFINID:ZDB-GENE-070620-26 Length:338 Species:Danio rerio


Alignment Length:332 Identity:88/332 - (26%)
Similarity:151/332 - (45%) Gaps:62/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQR--KAQI----------AINEYLLEELGDKN 58
            :::|::.|:.||:|||.::..:|...|:..|.|.|  |.|.          .:.|:|::.|...|
Zfish    23 FLVLVLAYVLYLIFGALVFSAVELPYEEQLRQELRTVKQQFLEDNECLSNDRLEEFLIKALEASN 87

  Fly    59 TTTQDEILQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMI 123
            ...  .:|...|               :.:.|.|..|.|||.||.||.|||:..|.:..|:...|
Zfish    88 YGV--SVLNNAS---------------SNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCI 135

  Fly   124 AYSVIGIPVNGILFAGLGEYF-----GRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIP 183
            .|||:|||...:....:.:..     .|..|.::||:...|         |.|..:...::|:|.
Zfish   136 IYSVVGIPFTLLFLTAVVQRIMEFSTRRPIEFLHRRWGTSK---------PLLAAMHATLLAIIT 191

  Fly   184 GIALFLLLPSWVFTYF-ENWPYSISLYYSYVTTTTIGFGDYVPTFGANQP-KEFGGWFVVYQIFV 246
             ::.|.|:|:.:|:.. |.|.:..|.|:.:::.:|||.|||||..|.:|. :|      :|::.:
Zfish   192 -VSCFFLIPAIIFSVLEEEWNFLESFYFCFISLSTIGLGDYVPGEGYHQRFRE------LYKLGI 249

  Fly   247 IVWFIFSL-GYLVMIMTFITRGLQS----KKLAYLEQQLSS---NLKATQNRIWSGVTKDVGYLR 303
            ..:.|..| ..||::.||..  ||.    :|:.||.:|.:.   |:....:..::.|:......|
Zfish   250 TFYLILGLIAMLVVLETFCE--LQQLKKLRKMFYLRKQKTEDQLNIVDHDHLSFASVSDQAASFR 312

  Fly   304 RMLNELY 310
            ....||:
Zfish   313 EDKTELF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 22/53 (42%)
Ion_trans_2 185..269 CDD:285168 26/86 (30%)
kcnk1aNP_001092223.1 Ion_trans_2 97..158 CDD:285168 23/75 (31%)
Ion_trans_2 191..267 CDD:285168 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.