DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnk16

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_083282.1 Gene:Kcnk16 / 74571 MGIID:1921821 Length:292 Species:Mus musculus


Alignment Length:282 Identity:83/282 - (29%)
Similarity:136/282 - (48%) Gaps:43/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGD-KNTTTQD-----EILQ 67
            ||:.||.||:.||.|:..:|...|..||          :::.||:|.. :|.|..|     :.:|
Mouse    17 LLLAYICYLLLGATIFQLLEKQAEAQSR----------DQFQLEKLRFLENYTCLDQQALEQFVQ 71

  Fly    68 RISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPV 132
            .|.:...|.|. |......|..|.|..:||||.||.:|:||||::|:|.||::..:.|:::|||:
Mouse    72 VILEAWVKGVN-PKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALMGIPL 135

  Fly   133 NGILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIPGIALFLLLPSWVFT 197
            |.:....||... |.......|::.:...:.:..|   |||    .:.|..|..:.|:.|...|:
Mouse   136 NVVFLNHLGTGL-RAHLTTLDRWEDHPRHSQLLQV---LGL----ALFLTLGTLVILIFPPMFFS 192

  Fly   198 YFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWFIFSLGYLVMIMT 262
            :.|.|.:....|::::|.:||||||||  .|.:..|.:   ..||:....:|.:..|.:|.::::
Mouse   193 HVEGWSFREGFYFAFITLSTIGFGDYV--VGTDPSKHY---IAVYRSLAAIWILLGLAWLAVVLS 252

  Fly   263 F-------------ITRGLQSK 271
            .             :.|||..|
Mouse   253 LGSLLLHRCSRLWQLIRGLDLK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 24/53 (45%)
Ion_trans_2 185..269 CDD:285168 24/96 (25%)
Kcnk16NP_083282.1 Ion_trans_2 <92..148 CDD:285168 24/56 (43%)
Ion_trans_2 180..248 CDD:285168 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845641
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm43345
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.