DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnk13

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_071629.2 Gene:Kcnk13 / 64120 RGDID:68941 Length:405 Species:Rattus norvegicus


Alignment Length:321 Identity:80/321 - (24%)
Similarity:138/321 - (42%) Gaps:53/321 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRI 69
            |::||....:.||:.|||::..:|..:|  .:|:||.      |..|......:..:::|:...:
  Rat    19 RFLLLAGLILLYLLGGAAVFSALELAQE--LQAKQRW------EERLANFSRGHNLSREELRGFL 75

  Fly    70 SDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNG 134
            ..| ::........|.....|.|..||:|..||.:|:|:|..:|.|..|::.:|.|.:||. .:.
  Rat    76 RHY-EEATKAGIRMDSVRPRWDFTGAFYFVGTVVTTIGFGMTTPATTGGKVFLIFYGLIGC-AST 138

  Fly   135 ILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLIT------------------------ 175
            |||..|  :..|....|     .|.|.|..|....:.|.:.                        
  Rat   139 ILFFNL--FLERLITVI-----AYVMRTCHHQQLRRRGTVARDNGKAPRKGEADSLAGWKPSVYY 196

  Fly   176 TVVIALIPGIALFLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFV 240
            .::|..:..:|: ....|.::|..|.|.|..|:|:.:|..:||||||.|.:..|....| |.:..
  Rat   197 VMLILCLASVAI-SCGASALYTTMEGWSYFDSVYFCFVAFSTIGFGDLVSSQNAQYENE-GLYRF 259

  Fly   241 VYQIFVI--VWFIFSLGYLVMIM-----TFITRGLQSKKLAYLEQQLSSNLKATQNRIWSG 294
            |...|::  |..|:|:..::.|:     .:|.|.|.|......::.|   |::.:|.:..|
  Rat   260 VNFFFILMGVCCIYSMFNVISILIKQTVNWILRKLDSGCFPQCQRGL---LRSRRNVVMPG 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 21/53 (40%)
Ion_trans_2 185..269 CDD:285168 27/90 (30%)
Kcnk13NP_071629.2 Ion_trans_2 88..150 CDD:400301 23/64 (36%)
Ion_trans_2 203..285 CDD:400301 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.