DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNK15

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_071753.2 Gene:KCNK15 / 60598 HGNCID:13814 Length:330 Species:Homo sapiens


Alignment Length:282 Identity:74/282 - (26%)
Similarity:130/282 - (46%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINE--YLLEELGDKNTTTQDEILQRISD 71
            |::..:.||:.|||::..:|      |.||..:.::.:.:  .|..:.|......::  |:|::.
Human    11 LVLCTLCYLLVGAAVFDALE------SEAESGRQRLLVQKRGALRRKFGFSAEDYRE--LERLAL 67

  Fly    72 YCDKPVTLPPTYDDTPY----TWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPV 132
            ..:            |:    .|.|..:|:||.||.:|:.||:.:|.|.:|::..:.|:::|||:
Human    68 QAE------------PHRAGRQWKFPGSFYFAITVITTIEYGHAAPGTDSGKVFCMFYALLGIPL 120

  Fly   133 NGILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITT------VVIALIPGIALFLLL 191
            ..:.|..|||    ...|:.||.        :......|||..|      :|:|.:...|..|.|
Human   121 TLVTFQSLGE----RLNAVVRRL--------LLAAKCCLGLRWTCVSTENLVVAGLLACAATLAL 173

  Fly   192 PSWVFTYFENWPYSISLYYSYVTTTTIGFGDYV--PTFGANQPKEFGGWFVVYQIFVIVWFIFSL 254
            .:..|::||.|.:..:.||.::|.|||||||:|  .:..|.|.|             :.:..||.
Human   174 GAVAFSHFEGWTFFHAYYYCFITLTTIGFGDFVALQSGEALQRK-------------LPYVAFSF 225

  Fly   255 GYLVMIMTFITRGLQSKKLAYL 276
            .|:::.:|.|...|....|.:|
Human   226 LYILLGLTVIGAFLNLVVLRFL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 21/53 (40%)
Ion_trans_2 185..269 CDD:285168 26/85 (31%)
KCNK15NP_071753.2 Ion_trans_2 <77..132 CDD:285168 21/58 (36%)
Ion_trans_2 176..243 CDD:285168 24/79 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..276
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.