DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNK13

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_071337.2 Gene:KCNK13 / 56659 HGNCID:6275 Length:408 Species:Homo sapiens


Alignment Length:391 Identity:93/391 - (23%)
Similarity:158/391 - (40%) Gaps:77/391 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIE--HGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQ 67
            |::||....:.||:.|||::..:|  |..:...|.|:|.|..:....|          ::||:..
Human    19 RFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNL----------SRDELRG 73

  Fly    68 RISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPV 132
            .:..| ::........|:....|.|..||:|..||.||:|:|..:|.|..|::.:|.|.::|.. 
Human    74 FLRHY-EEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCS- 136

  Fly   133 NGILFAGLGEYFGRTFEAI-YRRYKKYKMSTDMHYVPPQLGL-----------------ITTVVI 179
            :.|||..|  :..|....| |.....::.........||..|                 :..|::
Human   137 STILFFNL--FLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVML 199

  Fly   180 ALIPGIALFLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQI 244
            .|.....|.....|.::|..|.|.|..|||:.:|..:||||||.|.:..|:...: |.:.....:
Human   200 ILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQ-GLYRFANFV 263

  Fly   245 FVI--VWFIFSLGYLVMI-----MTFITRGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVGYL 302
            |::  |..|:||..::.|     :.:|.|.:.|......::.|   |::.:|.:..|..::...:
Human   264 FILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGL---LRSRRNVVMPGSVRNRCNI 325

  Fly   303 --------------RRMLNELYILKVKFCRKGNRKKPKNKAKTE--QKKKSSRYIAYTLPRSNSC 351
                          ||:..|:..:|....        .|||...  ||:.|.        .:|.|
Human   326 SIETDGVAESDTDGRRLSGEMISMKDLLA--------ANKASLAILQKQLSE--------MANGC 374

  Fly   352 P 352
            |
Human   375 P 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 21/53 (40%)
Ion_trans_2 185..269 CDD:285168 27/90 (30%)
KCNK13NP_071337.2 Ion_trans_2 <94..150 CDD:311712 22/58 (38%)
Ion_trans_2 206..285 CDD:311712 25/79 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.