DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and kcnk12l

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:XP_021324748.1 Gene:kcnk12l / 564796 ZFINID:ZDB-GENE-091118-74 Length:470 Species:Danio rerio


Alignment Length:290 Identity:73/290 - (25%)
Similarity:118/290 - (40%) Gaps:74/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQR-KAQIAINEYLLEELGDKNTTTQDEI--- 65
            |:.||....:.||:.||.::..:||..|  .:|.|| :.|:|            |.|.|:.:   
Zfish    42 RFGLLAALILLYLLCGAVVFSALEHPSE--VQAHQRWEEQLA------------NFTEQNSVHLK 92

  Fly    66 -LQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIG 129
             ||.:....::........|.....|.|..||:|..||.||:|:|..:|.|.||::.:|.|.::|
Zfish    93 SLQVLLRQYEEAFAAGIRVDKLRARWDFSGAFYFVGTVISTIGFGMTTPVTVAGKIFLIFYGLLG 157

  Fly   130 IPVNGILF-------------------------AGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPP 169
            .....:.|                         :|:|....|:.:.....:|     ..::||  
Zfish   158 CAATILFFNLFLERIITMLAYIMRWCHERQLRRSGVGGEEARSEDDSLEGWK-----PSVYYV-- 215

  Fly   170 QLGLITTVVIALIPGIALFLLL--PSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPT----FG 228
                      .||.|||..|:.  .|.:::..|.|.|..|.|:.:|..:||||||.|.:    :.
Zfish   216 ----------MLILGIAALLIACSASALYSAMEGWDYFESFYFCFVAFSTIGFGDVVSSQRENYK 270

  Fly   229 ANQPKEFG-------GWFVVYQIFVIVWFI 251
            |.:...||       |...:|.:|.::..|
Zfish   271 AQEAYRFGNCLFILMGVCCIYSLFNVISII 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 21/78 (27%)
Ion_trans_2 185..269 CDD:285168 24/80 (30%)
kcnk12lXP_021324748.1 Ion_trans_2 105..173 CDD:311712 20/67 (30%)
Ion_trans_2 221..303 CDD:311712 24/80 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.