DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNK10

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_612190.1 Gene:KCNK10 / 54207 HGNCID:6273 Length:543 Species:Homo sapiens


Alignment Length:319 Identity:85/319 - (26%)
Similarity:153/319 - (47%) Gaps:43/319 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RW---ILLLIFYISYLMFGAAIYYHIEHGEEK-------ISRAEQRKAQIAINEYLLEELGDKNT 59
            :|   :.:.:..:.||:.|..::..:|...|.       :.:||..:..:.::...||.|     
Human    73 KWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSPQELETL----- 132

  Fly    60 TTQDEILQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIA 124
                  :|...|..:..|:......:....|....|||||.||.:|:|||||:|:|..|::..|.
Human   133 ------IQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCIL 191

  Fly   125 YSVIGIPVNGILFAGLGE----YFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIPGI 185
            |::.|||:.|.|.||:|:    .||::...:.:.::|.::|      ..::.:|:|::. ::.|.
Human   192 YAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVS------QTKIRVISTILF-ILAGC 249

  Fly   186 ALFLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWF 250
            .:|:.:|:.:|.|.|.|....|:|:..||.||:||||:|.  |.|....:..|   |:..|..|.
Human   250 IVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVA--GGNAGINYREW---YKPLVWFWI 309

  Fly   251 IFSLGYLVMIMTFITRGLQ--SKKLAYLEQQLSSNLKATQNRIWSGVTKDVGYLRRMLN 307
            :..|.|...:::.|...|:  |||    .::....:||......:.||.:....||.|:
Human   310 LVGLAYFAAVLSMIGDWLRVLSKK----TKEEVGEIKAHAAEWKANVTAEFRETRRRLS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 27/57 (47%)
Ion_trans_2 185..269 CDD:285168 26/83 (31%)
KCNK10NP_612190.1 Ion_trans_2 153..211 CDD:285168 27/57 (47%)
Ion_trans_2 249..328 CDD:285168 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155147
Domainoid 1 1.000 65 1.000 Domainoid score I10023
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4331
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm41289
orthoMCL 1 0.900 - - OOG6_108298
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.