DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnk6

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001028697.2 Gene:Kcnk6 / 52150 MGIID:1891291 Length:313 Species:Mus musculus


Alignment Length:287 Identity:72/287 - (25%)
Similarity:117/287 - (40%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRI----- 69
            |..|..||..||.:...:|...|...|||..    .:.|.||:..........|..::|:     
Mouse    11 LAAYAGYLALGALLVARLERPHEARLRAELG----TLREQLLQHSPCVAAHALDAFVERVLAAGR 71

  Fly    70 ---------------SDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGR 119
                           ||               | .|.|..|.|||.|:.:|||||..:|.|.||:
Mouse    72 LGRAALANASGAANASD---------------P-AWDFASALFFASTLVTTVGYGYTTPLTDAGK 120

  Fly   120 MIMIAYSVIGIPVNGILFAGLGEYFGRTFEAIYRRYKKYKMS----------TDMHY-VPPQLGL 173
            ...|.::::|:|:..:|.....:                ::|          ..:|: .|||...
Mouse   121 AFSIVFALLGVPITMLLLTASAQ----------------RLSLLLTHAPLSWLSLHWGWPPQRAA 169

  Fly   174 ITTVVIALIPGIALFLLLPSWVFTYFEN-WPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGG 237
            ...:|..|:..:|:|.|:|:.||.|.|. |.:..:.|:.:::.:|||.|||||.....||     
Mouse   170 RWHLVALLMVIVAIFFLVPAAVFAYLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQP----- 229

  Fly   238 WFVVYQIFVIVWFIFSLGYLVMIM-TF 263
            :..:|::.|..:....|..:|::: ||
Mouse   230 YRALYKVLVTAYLFLGLVAMVLVLQTF 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 20/53 (38%)
Ion_trans_2 185..269 CDD:285168 26/81 (32%)
Kcnk6NP_001028697.2 Ion_trans_2 <91..146 CDD:285168 20/70 (29%)
Ion_trans <171..253 CDD:278921 26/86 (30%)
Ion_trans_2 180..259 CDD:285168 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845638
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.