DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNK9

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:XP_011515403.1 Gene:KCNK9 / 51305 HGNCID:6283 Length:401 Species:Homo sapiens


Alignment Length:302 Identity:84/302 - (27%)
Similarity:131/302 - (43%) Gaps:63/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIE-----HGEEKISRAEQR---KAQIAINEYLLEELGDKNTTT 61
            |.:.|::...:||:.|||::..:|     ..|||:...|.|   |..|:..:|...||       
Human     7 RTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLEL------- 64

  Fly    62 QDEILQRISDYCDKPVTLPPTYDDTPY----TWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIM 122
              .|||                 ..|:    .|.|..:|:||.||.:|:|||:.:|.|.||:...
Human    65 --VILQ-----------------SEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFC 110

  Fly   123 IAYSVIGIPVNGILFAGLGEYFGRTFEAIYRRYKKY--KMSTDMHYVPPQLGLITTVVIALIPGI 185
            :.|:|:|||:..::|..|||........:.:|.||.  ..:||:     .:..:.||......|.
Human   111 MFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDV-----SMENMVTVGFFSCMGT 170

  Fly   186 ALFLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYV--PTFGANQPKEFGGWFVVYQIFVIV 248
               |.:.:..|:..|.|.:..:.||.::|.|||||||||  .|.||.|.|.             :
Human   171 ---LCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKP-------------L 219

  Fly   249 WFIFSLGYLVMIMTFITRGLQSKKLAYLEQQLSSNLKATQNR 290
            :..||..|:::.:|.|...|....|.:|........:..:.|
Human   220 YVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEER 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 24/53 (45%)
Ion_trans_2 185..269 CDD:285168 26/85 (31%)
KCNK9XP_011515403.1 Ion_trans_2 <77..132 CDD:285168 24/54 (44%)
Ion_trans_2 170..243 CDD:285168 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.