DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and kcnk6

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001025245.2 Gene:kcnk6 / 504083 ZFINID:ZDB-GENE-050309-213 Length:315 Species:Danio rerio


Alignment Length:265 Identity:69/265 - (26%)
Similarity:126/265 - (47%) Gaps:35/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRISDYCD 74
            ::.|.:||:.||.::..||...|:..:|:....:.   |:|  .|...|:|..:..|:|:.....
Zfish    15 ILAYFTYLLLGALVFSAIERPIEESLKADLSSLKA---EFL--NLSCVNSTALETFLERVLKANK 74

  Fly    75 KPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNGILFAG 139
            ..|::... ......|....:.|||.|:.:|||||:.:|.:.||:...|.|::||:|...::...
Zfish    75 YGVSVLEN-ASLRTNWDLASSLFFANTMVTTVGYGHTTPLSDAGKAFSIVYALIGVPFTMLVLTA 138

  Fly   140 LGE-------YFGRTFEAIYRRYKKYKMSTD-MHYVPPQLGLITTVVIALIPGIALFLLLPSWVF 196
            ..:       |  |...|..||....:.|.. :|::         |::.|:  :..|.::||.||
Zfish   139 CVQRLMHPLTY--RPISACQRRAGLQQRSASVVHFI---------VLLFLV--VLCFFVVPSLVF 190

  Fly   197 TYF-ENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWFIFSLGYLVMI 260
            :.. |.|.:..:.|:.:::..|||.||:||   |.:|.:  ....:|:|.|:|:..  :|.:||.
Zfish   191 SAIEETWSFLDAFYFCFISLCTIGLGDFVP---AEKPGQ--SLRALYKISVMVYLF--VGLMVMF 248

  Fly   261 MTFIT 265
            :...|
Zfish   249 LVLRT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 18/60 (30%)
Ion_trans_2 185..269 CDD:285168 25/82 (30%)
kcnk6NP_001025245.2 Ion_trans_2 84..145 CDD:285168 18/60 (30%)
Ion_trans_2 178..254 CDD:285168 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590273
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.