DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and CG10864

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_650726.1 Gene:CG10864 / 42222 FlyBaseID:FBgn0038621 Length:389 Species:Drosophila melanogaster


Alignment Length:356 Identity:72/356 - (20%)
Similarity:128/356 - (35%) Gaps:96/356 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ISYLMFGAAIYYHIE---------HGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRI 69
            :.|.:.||..:.|||         |..|......|:...|.....:::.  .:.|...:::|:..
  Fly    58 VIYAICGAFAFMHIERQFVDETAGHVMELRQNCSQQLWSITEQHNIIDR--RRWTEATNDVLREY 120

  Fly    70 SDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNG 134
            .......|............|:|..|..|..:|.:.:||||:.|.|..|:...:.|:..|||:..
  Fly   121 QSQIAGVVKHGYVGRSPEQIWSFPAALMFCLSVITMIGYGNMVPRTPWGKGFTVIYATFGIPLYI 185

  Fly   135 ILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQL--------GLITTVVIALIPGIA----- 186
            :.|..:|....|:|:.:||....   .|..|   |:|        |:..|....::|..|     
  Fly   186 LYFLNMGRVLARSFKFLYRSLHD---CTQEH---PRLDRMDALEGGVGMTRKKVIVPSTACLWVI 244

  Fly   187 -LFLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWF 250
             .::|..:.:|..:|.|....|.|:...:...|||||:||  ||:                    
  Fly   245 FFYVLTGTVMFANWEKWSLLNSFYFCMTSLCKIGFGDFVP--GAS-------------------- 287

  Fly   251 IFSLGYLVMIMTFITRGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVGYLRRM---------- 305
                         :|              .|:::.|...::...::.|...|.::          
  Fly   288 -------------LT--------------TSADVNAATQKLQEDISADPAELAQLQSVAADQHSK 325

  Fly   306 --LNELYIL----KVKFCRKGNRKKPKNKAK 330
              :|.:|:|    .|..||...|::.:.||:
  Fly   326 LAINFVYMLLGMGLVAMCRNLMREEVRLKAR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 18/53 (34%)
Ion_trans_2 185..269 CDD:285168 17/89 (19%)
CG10864NP_650726.1 Ion_trans_2 124..197 CDD:285168 19/72 (26%)
Ion_trans_2 242..>284 CDD:285168 11/41 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.