DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Task6

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster


Alignment Length:386 Identity:94/386 - (24%)
Similarity:172/386 - (44%) Gaps:73/386 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKIS-RAEQRKAQIAINEYLLEELGDKNTTTQD-EILQ 67
            |.|.|::...:||:.|||::..:|...||.. .|.|....:.|.:|        |.:.:| ::::
  Fly     7 RTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKY--------NISQEDFKVME 63

  Fly    68 RISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPV 132
                    .|.|..........|.|..||::|.||.:|:|||:.:|:|..|::..:.|:::|||:
  Fly    64 --------TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPL 120

  Fly   133 NGILFAGLGEYFGRTFEAIYRRYK-----KYKMSTDMHYVPPQLGLITTVVIALIPGIALFLLLP 192
            ..::|..:||...|....:.:..:     |..:::::..:    .::||:....|.|.|.     
  Fly   121 GLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVDLI----CVVTTLSSLTIAGGAA----- 176

  Fly   193 SWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGAN----QPKEFGGWFVVYQIFVIVWFIFS 253
              .|:.||.|.|..|:||.::|.|||||||.|.....|    :|:        |.:|.:::.:|.
  Fly   177 --AFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPE--------YVMFALIFILFG 231

  Fly   254 LGYL-----VMIMTFIT-----------RGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVGYL 302
            |..:     ::::.|:|           :.:|:.::|.   :|..::..:...|.||.....|..
  Fly   232 LAIVAASLNLLVLRFVTMNTEDERRDEAQAMQALQVAV---KLEGDVITSNGSILSGYEGHDGQS 293

  Fly   303 RRMLNELYILKVK-FCRKGNRKK------PKNKAKTEQK-KKSSRYIAYTLPRSNSCPDLS 355
            ....|...:.... .|..|||.|      ..|.|:.:.| ::|..:|.:.||......||:
  Fly   294 LNGSNTSSMCSCHCICLNGNRHKKSSNLEKNNDAENQYKLRQSPTHIRHLLPEVVPMQDLN 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 21/53 (40%)
Ion_trans_2 185..269 CDD:285168 26/103 (25%)
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 21/54 (39%)
Ion_trans_2 169..247 CDD:285168 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461308
Domainoid 1 1.000 56 1.000 Domainoid score I2685
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
65.940

Return to query results.
Submit another query.