DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Task7

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster


Alignment Length:297 Identity:79/297 - (26%)
Similarity:139/297 - (46%) Gaps:56/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRK---AQIAINEYLLEELGDKNTTTQDEIL 66
            |.:.|::...:||:.|||::..:|      |..|.::   .|...|.::.:    .|.|.:|..:
  Fly     8 RTLSLVVCTFTYLLIGAAVFDSLE------SPTEAKRWEFLQTVKNNFVRK----YNVTDEDFRV 62

  Fly    67 QRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIP 131
            ..|....:||....|       .|.|..||:|:..|.:.:|||:.:|.|..|:...:.|:::|||
  Fly    63 MEIVIIENKPHKAGP-------QWKFAGAFYFSTVVLAMIGYGHSTPVTIPGKAFCMGYAMVGIP 120

  Fly   132 VNGILFAGLGEYFGRTFEAIYRRYKKYK-----MSTDMHYVPPQLGLITTVVIALIPGIALFLLL 191
            :..::|..:||...:....|.||.|:..     .:|:|:.: ...|::::::|.  .|.|     
  Fly   121 LGLVMFQSIGERLNKFASVIIRRAKRASGARCTDATEMNLM-LATGMLSSIIIT--TGAA----- 177

  Fly   192 PSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFG----ANQPKEFGGWFVVYQIFVIVWFIF 252
               ||:.:|.|.|..|.||.:||.|||||||||....    .|:|.        |....:|:.:|
  Fly   178 ---VFSRYEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKPG--------YVALSLVFILF 231

  Fly   253 SLGYL-----VMIMTFITRGLQSKKLAYLEQQLSSNL 284
            .|..:     ::::.|:|...:..|   .::|.:.||
  Fly   232 GLAVVAASINLLVLRFMTMQAEDAK---RDEQDAQNL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 19/53 (36%)
Ion_trans_2 185..269 CDD:285168 28/92 (30%)
Task7NP_649891.1 Ion_trans_2 <78..133 CDD:285168 19/54 (35%)
Ion_trans_2 166..248 CDD:285168 28/99 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
54.940

Return to query results.
Submit another query.