DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNK3

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_002237.1 Gene:KCNK3 / 3777 HGNCID:6278 Length:394 Species:Homo sapiens


Alignment Length:276 Identity:69/276 - (25%)
Similarity:134/276 - (48%) Gaps:35/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKIS------RAEQRKAQIAINEYLLEELGDKNTTTQD 63
            |.:.|::...:||:.|||::..:|...|.|.      |.::.:|:..:::...|||        :
Human     7 RTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYEEL--------E 63

  Fly    64 EILQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVI 128
            .::.|:     ||       ......|.|..:|:||.||.:|:|||:.:|:|..|::..:.|:::
Human    64 RVVLRL-----KP-------HKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALL 116

  Fly   129 GIPVNGILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIPGIALFLLLPS 193
            |||:..::|..|||........:..|.||     .:......:.:...|:|.....|:. |.:.:
Human   117 GIPLTLVMFQSLGERINTLVRYLLHRAKK-----GLGMRRADVSMANMVLIGFFSCIST-LCIGA 175

  Fly   194 WVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWFIFSLGYL- 257
            ..|:::|:|.:..:.||.::|.||||||||| ....:|..:....:|.:....|:..:..:|.. 
Human   176 AAFSHYEHWTFFQAYYYCFITLTTIGFGDYV-ALQKDQALQTQPQYVAFSFVYILTGLTVIGAFL 239

  Fly   258 -VMIMTFITRGLQSKK 272
             ::::.|:|...:.:|
Human   240 NLVVLRFMTMNAEDEK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 22/53 (42%)
Ion_trans_2 185..269 CDD:285168 23/85 (27%)
KCNK3NP_002237.1 Ion_trans_2 <77..132 CDD:400301 22/54 (41%)
Ion_trans_2 167..247 CDD:400301 21/81 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..286
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2545
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.