DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNC2

DIOPT Version :10

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_631875.1 Gene:KCNC2 / 3747 HGNCID:6234 Length:638 Species:Homo sapiens


Alignment Length:59 Identity:16/59 - (27%)
Similarity:24/59 - (40%) Gaps:5/59 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LPSAPFGVPLLDSGSATAG---TQLVMFGSLVKLLESSKQTT--SDNNTAVGLIKSING 180
            |.::.:||.:|.:.|....   |..:.|.|.|........|.  ||...|..:|.|:.|
Human    83 LEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIG 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 83..144 CDD:462301 5/16 (31%)
Ion_trans_2 185..266 CDD:462301
KCNC2NP_631875.1 BTB_KCNC2_4 7..166 CDD:349722 16/59 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..93 3/9 (33%)
Ion_trans 228..484 CDD:459842
Selectivity filter. /evidence=ECO:0000250 437..442
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 538..572
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.