DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and CG34396

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster


Alignment Length:379 Identity:83/379 - (21%)
Similarity:142/379 - (37%) Gaps:115/379 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NRWILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDE---- 64
            ||.|..||.....|.||..::.:.|...|.|.:.|.||    :....::.|.|.:...::|    
  Fly   524 NRCIAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRK----VKRDFIDRLWDVSHNMREEDWKS 584

  Fly    65 -ILQRISDYCDKPVTLPP----TYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIA 124
             ..|::..:.|:...|..    .|.... :|.|.:.|.|.:||.:|:|||:|:|.|..||.:.|.
  Fly   585 LARQKLRSFEDELNNLAELGLRRYPGQK-SWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIV 648

  Fly   125 YSVIGIPVNGILFAGLGEYFGRTFEAIY------------RRYKK--------------YKMS-- 161
            |::||||:..|:.|.||:.|.|..:.::            ||.:|              |.|:  
  Fly   649 YAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIR 713

  Fly   162 ---------------------------------------------TDMHYVPPQLGLITTVVIAL 181
                                                         .|...:|..:..:..:...|
  Fly   714 RPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYIL 778

  Fly   182 IPGIALFLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFV 246
            :......::.|||.       |.. :.||.:::.:||||||.||    :.|        .|.:..
  Fly   779 LGSFGFLMMEPSWT-------PLD-AFYYVFISMSTIGFGDLVP----SNP--------FYVMVS 823

  Fly   247 IVWFIFSLGYLVMIMTFITRGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVG 300
            :::.:|.|....|.:..:     ..||:...:..|:.:.||   |...:|.::|
  Fly   824 MIYLMFGLALTSMFINVV-----QIKLSDHFKMASAKVGAT---IGMNMTSELG 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 25/53 (47%)
Ion_trans_2 185..269 CDD:285168 19/83 (23%)
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 26/55 (47%)
Ion_trans_2 771..847 CDD:285168 22/100 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461331
Domainoid 1 1.000 56 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.