DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNA3

DIOPT Version :10

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_002223.3 Gene:KCNA3 / 3738 HGNCID:6221 Length:575 Species:Homo sapiens


Alignment Length:148 Identity:26/148 - (17%)
Similarity:52/148 - (35%) Gaps:60/148 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRISD 71
            :|:...:|..::|.:|:|:           ||                                 
Human   400 LLIFFLFIGVILFSSAVYF-----------AE--------------------------------- 420

  Fly    72 YCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGI-----P 131
             .|.|.:   .:...|      .||::|....:|||||::.|.|..|:::....::.|:     |
Human   421 -ADDPTS---GFSSIP------DAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALP 475

  Fly   132 VNGILFAGLGEYFGRTFE 149
            | .::.:....::.|..|
Human   476 V-PVIVSNFNYFYHRETE 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 83..144 CDD:462301 15/65 (23%)
Ion_trans_2 185..266 CDD:462301
KCNA3NP_002223.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
BTB_POZ 104..230 CDD:453885
Ion_trans 233..490 CDD:459842 24/144 (17%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 444..449 4/4 (100%)
Interaction with KCNE4. /evidence=ECO:0000250|UniProtKB:P15384 482..575 2/11 (18%)
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P15384 573..575
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.