DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and KCNA1

DIOPT Version :10

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_000208.2 Gene:KCNA1 / 3736 HGNCID:6218 Length:495 Species:Homo sapiens


Alignment Length:148 Identity:24/148 - (16%)
Similarity:55/148 - (37%) Gaps:60/148 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRISD 71
            :|:...:|..::|.:|:|:         :.||:.::..:                          
Human   328 LLIFFLFIGVILFSSAVYF---------AEAEEAESHFS-------------------------- 357

  Fly    72 YCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGI-----P 131
                  ::|             .||::|....:|||||::.|.|..|:::....::.|:     |
Human   358 ------SIP-------------DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALP 403

  Fly   132 VNGILFAGLGEYFGRTFE 149
            | .::.:....::.|..|
Human   404 V-PVIVSNFNYFYHRETE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 83..144 CDD:462301 14/65 (22%)
Ion_trans_2 185..266 CDD:462301
KCNA1NP_000208.2 Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P10499 1..128
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
BTB_POZ 37..163 CDD:453885
Ion_trans 166..418 CDD:459842 22/144 (15%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 310..323
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 372..377 4/4 (100%)
PDZ-binding. /evidence=ECO:0000250 493..495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.