DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnk3

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_203694.1 Gene:Kcnk3 / 29553 RGDID:61997 Length:411 Species:Rattus norvegicus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:134/271 - (49%) Gaps:25/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAIN-EYLLEELGDKNTTTQDEILQR 68
            |.:.|::...:||:.|||::..:|...|.|.|......|:.:. .|.|.|.|       .|.|:|
  Rat     7 RTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQLELRARYNLSEGG-------YEELER 64

  Fly    69 ISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVN 133
            :      .:.|.|  ......|.|..:|:||.||.:|:|||:.:|:|..|::..:.|:::|||:.
  Rat    65 V------VLRLKP--HKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLT 121

  Fly   134 GILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIPGIALFLLLPSWVFTY 198
            .::|..|||.. .||.    ||..::....:.....::.:...|:|..:..|:. |.:.:..|:|
  Rat   122 LVMFQSLGERI-NTFV----RYLLHRAKRGLGMRHAEVSMANMVLIGFVSCIST-LCIGAAAFSY 180

  Fly   199 FENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWFIFSLGYL--VMIM 261
            :|.|.:..:.||.::|.||||||||| ....:|..:....:|.:....|:..:..:|..  ::::
  Rat   181 YERWTFFQAYYYCFITLTTIGFGDYV-ALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNLVVL 244

  Fly   262 TFITRGLQSKK 272
            .|:|...:.:|
  Rat   245 RFMTMNAEDEK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 22/53 (42%)
Ion_trans_2 185..269 CDD:285168 24/85 (28%)
Kcnk3NP_203694.1 Ion_trans_2 <77..132 CDD:285168 22/54 (41%)
Ion_trans_2 167..247 CDD:285168 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.