DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnv2

DIOPT Version :10

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001099840.1 Gene:Kcnv2 / 294065 RGDID:1309271 Length:561 Species:Rattus norvegicus


Alignment Length:84 Identity:28/84 - (33%)
Similarity:46/84 - (54%) Gaps:12/84 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DTPYT--WTFYHAFFFAFTVCSTVGYGNISPTTFAGRM---IMIAYSVI--GIPVNGILFAGLGE 142
            |.|.|  .:..||:::|....||||||::.|.|..||:   :.||:.:|  |:|:: ||:....:
  Rat   451 DVPGTNFTSILHAWWWAAVSISTVGYGDMYPETHLGRLFAFLCIAFGIILNGMPIS-ILYNKFSD 514

  Fly   143 YFGR----TFEAIYRRYKK 157
            |:.:    .:.||.|...|
  Rat   515 YYSKLKAYEYTAIRRERGK 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 83..144 CDD:462301 23/65 (35%)
Ion_trans_2 185..266 CDD:462301
Kcnv2NP_001099840.1 BTB_POZ 106..213 CDD:453885
Ion_trans 275..520 CDD:459842 24/69 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.