DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnk9

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:XP_006520831.1 Gene:Kcnk9 / 223604 MGIID:3521816 Length:604 Species:Mus musculus


Alignment Length:388 Identity:100/388 - (25%)
Similarity:160/388 - (41%) Gaps:81/388 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIE-----HGEEKISRAEQR---KAQIAINEYLLEELGDKNTTT 61
            |.:.|:....:||:.|||::..:|     ..|||:...|.|   |..|:.::|...||       
Mouse   209 RTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRLRGKYNISSDDYQQLEL------- 266

  Fly    62 QDEILQRISDYCDKPVTLPPTYDDTPY----TWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIM 122
              .|||                 ..|:    .|.|..:|:||.||.:|:|||:.:|.|.||:...
Mouse   267 --VILQ-----------------SEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFC 312

  Fly   123 IAYSVIGIPVNGILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIPGIAL 187
            :.|:|:|||:..::|..|||........:.:|.||   ...|......:..:.||......|.  
Mouse   313 MFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKK---CCGMRNTEVSMENMVTVGFFSCMGT-- 372

  Fly   188 FLLLPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYV--PTFGANQPKEFGGWFVVYQIFVIVWF 250
             |.|.:..|:..|:|.:..:.||.::|.|||||||:|  ...||.|.|.|   :|.:....|:..
Mouse   373 -LCLGAAAFSQCEDWSFFHAYYYCFITLTTIGFGDFVALQAKGALQRKPF---YVAFSFMYILVG 433

  Fly   251 IFSLGYL--VMIMTFITRGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVGYLRRMLNELYILK 313
            :..:|..  ::::.|:|.....:   .||.:::..|.....|    |:......|:..:.:|.|:
Mouse   434 LTVIGAFLNLVVLRFLTMNTDEE---LLEGEVAEILAGNPRR----VSVRAPQRRKRHHAMYFLR 491

  Fly   314 VKF-------CRKGNRKKPKNKAKTEQKKKSSRY---IAYTLPRSNSCPDLSMYRVEPAPIPS 366
             |:       |..|.     |..|.:........   :..|.|.|...|       .|||.|:
Mouse   492 -KYGRTLCYLCFPGT-----NWGKDDDDDDDDDVVDNVVVTAPISAPAP-------APAPAPA 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 24/53 (45%)
Ion_trans_2 185..269 CDD:285168 26/87 (30%)
Kcnk9XP_006520831.1 Ion_trans_2 <279..334 CDD:400301 24/54 (44%)
Ion_trans_2 372..445 CDD:400301 24/78 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.