DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnk12

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_954859.1 Gene:Kcnk12 / 210741 MGIID:2684043 Length:430 Species:Mus musculus


Alignment Length:434 Identity:98/434 - (22%)
Similarity:162/434 - (37%) Gaps:103/434 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRI 69
            |::||......||:.||.::..:|...|..:||.....        |......:...:.|:...:
Mouse    38 RFVLLAALIGLYLVAGATVFSALESPGEAEARARWGAT--------LRNFSAAHGVAEPELRAFL 94

  Fly    70 SDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNG 134
            ..| :..:......|.....|.|..||:|..||.||:|:|..:|.|..|:..:|||.:.|. ...
Mouse    95 RHY-EAALAAGVRADALRPRWDFPGAFYFVGTVVSTIGFGMTTPATVGGKAFLIAYGLFGC-AGT 157

  Fly   135 ILFAGLGEYFGRTFE---------------------AIYRRYKKYKMSTDMHYVPPQLGLITTVV 178
            |||..|  :..|...                     |.:||......:..:....|     :...
Mouse   158 ILFFNL--FLERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKP-----SVYH 215

  Fly   179 IALIPGIALFLL--LPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGA---NQPKEFGGW 238
            :.||.|:...||  ..|.::|..|.|.|..|||:.:||.:||||||.|.:..|   ||.....|.
Mouse   216 VLLILGLFAVLLACCASAMYTSVEGWDYVDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGN 280

  Fly   239 FVVYQIFVI--VWFIFSLGYLVMIMTFITRGLQSKKLAYLEQQLSSNLKATQNRIWSGVTKDVGY 301
            |    :|::  |..|:||..::.|:                                        
Mouse   281 F----LFILLGVCCIYSLFNVISIL---------------------------------------- 301

  Fly   302 LRRMLNELYILKVKFCRKGNRKKPKNKAKTEQKKKSSRYIAYTLPRSNSCPDLSMYRVEPAPIPS 366
            ::::||  ::|:...||...|..|...|...::.      |.| |.|.....|:....:||...|
Mouse   302 IKQVLN--WMLRKLSCRCCTRCCPAPGAPLARRN------AIT-PGSRLRRRLAALGADPATRDS 357

  Fly   367 RKRAFSVCADMVAAQREAGMVHANSDTELSKLDREKTFETAEAY 410
            ......:..::::.:.    :.|::...|:.|.::.: |||..|
Mouse   358 DAEGRRLSGELISMRD----LTASNKVSLALLQKQLS-ETANGY 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 22/53 (42%)
Ion_trans_2 185..269 CDD:285168 30/90 (33%)
Kcnk12NP_954859.1 Ion_trans_2 101..169 CDD:400301 24/70 (34%)
Ion_trans_2 222..304 CDD:400301 30/125 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.