DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and twk-39

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001076639.1 Gene:twk-39 / 182864 WormBaseID:WBGene00006690 Length:676 Species:Caenorhabditis elegans


Alignment Length:187 Identity:45/187 - (24%)
Similarity:83/187 - (44%) Gaps:36/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIFYIS-YLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKN----TTTQDEILQRI 69
            |.|.:: |.:.||.::..:|:..|...:.:.:.|.:.:.:.:...:..||    |..::|....:
 Worm    29 LCFLVALYAVAGAFMFQAVEYPYELGLQGKVKNASLKVVDDIYRFINRKNVIEETAVKNESQWAL 93

  Fly    70 SDY------------CDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIM 122
            .::            .|:.....||:.     |||..|..::.||.:|:|||:|.|.|..||::.
 Worm    94 KEFEMLLVHAMNFEGYDEHDEERPTFQ-----WTFSGALLYSITVFTTIGYGHICPKTDTGRLLT 153

  Fly   123 IAYSVIGIPVNGILFAGLGEYFGRTFEAIY--------------RRYKKYKMSTDMH 165
            |.||::|||:..:..|.:.|...:.|..||              ||.::..:|...|
 Worm   154 ILYSILGIPLMLLCLANIAETLAQVFTYIYFKLCCAYCRWQKNRRRVRRAALSFRYH 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 23/53 (43%)
Ion_trans_2 185..269 CDD:285168
twk-39NP_001076639.1 Ion_trans_2 <120..177 CDD:285168 23/61 (38%)
Ion_trans_2 498..580 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.