DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and twk-46

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_741678.1 Gene:twk-46 / 180252 WormBaseID:WBGene00006696 Length:319 Species:Caenorhabditis elegans


Alignment Length:271 Identity:86/271 - (31%)
Similarity:131/271 - (48%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ISYLMFGAAIYYHIEHGEEKISRA---------EQRKAQIAINEYLLEELGDKNTTTQDEILQRI 69
            :.||..||.::..||:..|||.|.         ..|..|:.|:|..:::|   ....::..|..|
 Worm    35 VVYLFVGAIVFVRIEYPLEKIEREAYLDYQNQWRDRLIQLDIDESEIDKL---FLNIREAALNGI 96

  Fly    70 SDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNG 134
              :.|:.:|..|       .|||..|||||.|:.||||||.:||.|..|::..|.|.|||||:..
 Worm    97 --WMDRNLTSDP-------NWTFGQAFFFAGTLISTVGYGRVSPRTEYGKLFTILYCVIGIPLTL 152

  Fly   135 ILFAGLGEYFGRTFEAIYRRYKK--YKMSTDMHYVPPQLGLITTV-------VIALIPGIALFLL 190
            .|.:           ||..|.::  :|:...::   .:||.:.||       |..:...:.||:.
 Worm   153 ALLS-----------AIVARMREPSHKLRGLLN---QRLGHLFTVNHIQLIHVGVVFASLLLFVF 203

  Fly   191 -LPSWVFTYFE-NWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWFIFS 253
             :|:|||:..| :|.|..:.||.:|:.||||.||:.|....||  .|.|   :|:|...|:.   
 Worm   204 AIPAWVFSSIETDWSYLDAFYYCFVSLTTIGLGDFEPGDDPNQ--SFRG---LYKIGATVYL--- 260

  Fly   254 LGYLVMIMTFI 264
            :|.|..:|.|:
 Worm   261 MGGLCCMMLFL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 27/53 (51%)
Ion_trans_2 185..269 CDD:285168 30/82 (37%)
twk-46NP_741678.1 Ion_trans_2 <107..164 CDD:285168 30/67 (45%)
Ion_trans_2 198..274 CDD:285168 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.