DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and kvs-5

DIOPT Version :10

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001294321.1 Gene:kvs-5 / 176899 WormBaseID:WBGene00021948 Length:600 Species:Caenorhabditis elegans


Alignment Length:59 Identity:18/59 - (30%)
Similarity:29/59 - (49%) Gaps:9/59 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPV 132
            |:|.|   .:...|.|      |::.....:|||||::.|.|.||:::.....|.|:.|
 Worm   518 DEPGT---KFTSIPAT------FWWCVVTMATVGYGDLVPVTVAGKLVGSGAIVCGVMV 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 83..144 CDD:462301 15/50 (30%)
Ion_trans_2 185..266 CDD:462301
kvs-5NP_001294321.1 BTB_POZ_Kv 139..228 CDD:349626
Ion_trans 388..587 CDD:459842 18/59 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.