DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnk2

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_742039.1 Gene:Kcnk2 / 170899 RGDID:621448 Length:426 Species:Rattus norvegicus


Alignment Length:354 Identity:98/354 - (27%)
Similarity:164/354 - (46%) Gaps:57/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RW-----ILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDE 64
            :|     |.|::  :.||:.||.::..:|..:|    ..||...:...:..:.:....|:|..||
  Rat    58 KWKTVSTIFLVV--VLYLIIGATVFKALEQPQE----ISQRTTIVIQKQNFIAQHACVNSTELDE 116

  Fly    65 ILQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIG 129
            ::|:|....:..:.......:....|....:||||.||.:|:|:|||||.|..|::..|.|:::|
  Rat   117 LIQQIVTAINAGIIPLGNNSNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLG 181

  Fly   130 IPVNGILFAG----LGEYFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIPGIALFLL 190
            ||:.|.|.||    ||..||:....:...:.|:.:|      ..::.:|:|::..|. |..||:.
  Rat   182 IPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVS------QTKIRIISTIIFILF-GCVLFVA 239

  Fly   191 LPSWVFTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFV--IVWF--I 251
            ||:.:|.:.|.|....::|:..:|.|||||||||.          ||..:.|..|.  :|||  :
  Rat   240 LPAVIFKHIEGWSALDAIYFVVITLTTIGFGDYVA----------GGSDIEYLDFYKPVVWFWIL 294

  Fly   252 FSLGYLVMIMTFITRGLQ--SKKLAYLEQQLSSNLKATQNRIWSGVTKDVGYLRRMLN-ELYILK 313
            ..|.|...:::.|...|:  |||    .::.....:|......:.||.:....||.|: |:|   
  Rat   295 VGLAYFAAVLSMIGDWLRVISKK----TKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIY--- 352

  Fly   314 VKFCRKGNRKKPKNKAKTEQKKKSSRYIA 342
                       .|.:..|..|:|.|..:|
  Rat   353 -----------DKFQRATSVKRKLSAELA 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 27/57 (47%)
Ion_trans_2 185..269 CDD:285168 28/87 (32%)
Kcnk2NP_742039.1 Ion_trans_2 <139..196 CDD:285168 25/56 (45%)
Ion_trans_2 234..312 CDD:285168 28/87 (32%)
Required for basal channel activity. /evidence=ECO:0000250|UniProtKB:P97438 354..426 6/17 (35%)
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250|UniProtKB:P97438 378..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349061
Domainoid 1 1.000 66 1.000 Domainoid score I9680
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm45417
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.