DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnk7

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_034739.2 Gene:Kcnk7 / 16530 MGIID:1341841 Length:343 Species:Mus musculus


Alignment Length:297 Identity:61/297 - (20%)
Similarity:116/297 - (39%) Gaps:86/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWILLLIFYISYLMFGAAIYYHIE-----HGEEKIS------RAEQRKA--QIAINEYL------ 50
            |::|||:.::..:..||.:...:|     |.:.::.      :||.|..  ..|:.|.|      
Mouse     9 RYLLLLMAHLLAMGLGAVVLQALEGPPARHLQAQVQAELASFQAEHRACLPPEALEELLGAVLRA 73

  Fly    51 ----LEELGDKNTTTQDEILQRISDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNI 111
                :..||:.:.|:                           .|....|..|..::.:|.|||::
Mouse    74 QAHGVSSLGNSSETS---------------------------NWDLPSALLFTASILTTTGYGHM 111

  Fly   112 SPTTFAGRMIMIAYSVIGIPVNGILFAGLGE----YFGRTFEAIYRRYKKYKMSTDMHYVPPQLG 172
            :|.:..|:...:.|:.:|:|.:..|.|.|..    .|.|..:.:..|::         ..|.|..
Mouse   112 APLSSGGKAFCVVYAALGLPASLALVAALRHCLLPVFSRPGDWVAIRWQ---------LAPAQAA 167

  Fly   173 LITTVVIALIPGIALFLLLPSWVFTYFENWPYS------ISLYYSYVTTTTIGFGDYVPTFGAN- 230
            |:....:.|:.. .:|:|||:.|.     |...      .::|:.:.:.:|||.||.:|..|.. 
Mouse   168 LLQAAGLGLLVA-CVFMLLPALVL-----WGVQGDCSLLEAIYFCFGSLSTIGLGDLLPAHGRGL 226

  Fly   231 QPKEFGGWFVVYQI--FVIVWFIFSLGYLVMIMTFIT 265
            .|       .:|.:  |.::.::. ||.|.|::...|
Mouse   227 HP-------AIYHLGQFALLGYLL-LGLLAMLLAVET 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 15/57 (26%)
Ion_trans_2 185..269 CDD:285168 22/90 (24%)
Kcnk7NP_034739.2 Ion_trans_2 <89..140 CDD:285168 14/50 (28%)
Ion_trans_2 178..>225 CDD:285168 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.