DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and spp-30

DIOPT Version :10

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001257164.1 Gene:spp-30 / 13222892 WormBaseID:WBGene00206537 Length:117 Species:Caenorhabditis elegans


Alignment Length:55 Identity:12/55 - (21%)
Similarity:18/55 - (32%) Gaps:20/55 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 YLVMIMTFITRGLQSK--------------------KLAYLEQQLSSNLKATQNR 290
            ||:::..|......||                    |....::||.:.|.||..|
 Worm     8 YLILLACFTKMSCTSKPIDNCTYCVNVLKCVFGHFGKSVKSKRQLGNKLVATCKR 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 83..144 CDD:462301
Ion_trans_2 185..266 CDD:462301 3/9 (33%)
spp-30NP_001257164.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.