powered by:
Protein Alignment Ork1 and Y71H9A.10
DIOPT Version :9
Sequence 1: | NP_001285097.1 |
Gene: | Ork1 / 32020 |
FlyBaseID: | FBgn0017561 |
Length: | 1019 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257164.1 |
Gene: | Y71H9A.10 / 13222892 |
WormBaseID: | WBGene00206537 |
Length: | 117 |
Species: | Caenorhabditis elegans |
Alignment Length: | 55 |
Identity: | 12/55 - (21%) |
Similarity: | 18/55 - (32%) |
Gaps: | 20/55 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 256 YLVMIMTFITRGLQSK--------------------KLAYLEQQLSSNLKATQNR 290
||:::..|......|| |....::||.:.|.||..|
Worm 8 YLILLACFTKMSCTSKPIDNCTYCVNVLKCVFGHFGKSVKSKRQLGNKLVATCKR 62
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ork1 | NP_001285097.1 |
Ion_trans_2 |
<90..144 |
CDD:285168 |
|
Ion_trans_2 |
185..269 |
CDD:285168 |
3/12 (25%) |
Y71H9A.10 | NP_001257164.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1418 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.