DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and Kcnk6

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_446258.2 Gene:Kcnk6 / 116491 RGDID:621450 Length:313 Species:Rattus norvegicus


Alignment Length:273 Identity:71/273 - (26%)
Similarity:118/273 - (43%) Gaps:46/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRI--SDY 72
            |:.|..||..||.:...:|...|...|||..    .:.|.||...........|..::|:  :..
  Rat    11 LVAYAGYLALGALLVARLERPHEARLRAELG----TLREQLLRHSPCVAAHALDAFVERVLAAGR 71

  Fly    73 CDKPVTL----PPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVN 133
            ..:.|..    |....|.  .|.|..|.|||.|:.:|||||..:|.|.||:...|.::::|:|:.
  Rat    72 LGRAVLANASGPANASDP--AWDFASALFFASTLVTTVGYGYTTPLTDAGKAFSIVFALLGVPIT 134

  Fly   134 GILFAGLGEYFGRTFEAIYRRYKKYKMSTDMHYVP-----------PQLGLITTVVIALIPGIAL 187
            .:|.....:                ::|..:.:.|           ||......:|..|:..:|:
  Rat   135 MLLLTASAQ----------------RLSLLLTHAPLSWLSLRWGWHPQRAARWHLVALLMVIVAI 183

  Fly   188 FLLLPSWVFTYFEN-WPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWFI 251
            |.|:|:.||.|.|. |.:..:.|:.:::.:|||.|||||.....||     :..:|::.|..:..
  Rat   184 FFLIPAAVFAYLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQP-----YRSLYKVLVTAYLF 243

  Fly   252 FSLGYLVMIM-TF 263
            ..|..:|::: ||
  Rat   244 LGLVAMVLVLQTF 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 20/53 (38%)
Ion_trans_2 185..269 CDD:285168 26/81 (32%)
Kcnk6NP_446258.2 Ion_trans_2 <91..146 CDD:400301 20/70 (29%)
Ion_trans_2 180..259 CDD:400301 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm45417
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.