DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ork1 and LOC101731658

DIOPT Version :9

Sequence 1:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster
Sequence 2:XP_031758165.1 Gene:LOC101731658 / 101731658 -ID:- Length:331 Species:Xenopus tropicalis


Alignment Length:259 Identity:83/259 - (32%)
Similarity:134/259 - (51%) Gaps:31/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLIFYISYLMFGAAIYYHIE---HGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRI 69
            :||:.||.||:.|||:::.:|   ..|:.:| .:|.|.::..|...::     |.|.:..|...|
 Frog    20 ILLLIYICYLLVGAAVFWALESQTEVEQSVS-FQQDKWELLRNFTCMD-----NRTLELFIKTVI 78

  Fly    70 SDYCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGIPVNG 134
            ..|  |....|........:|:|..:|||:.||.:|:||||:.|:|...|...:.|::.|||:|.
 Frog    79 GAY--KSGISPEGNSSNLGSWSFGGSFFFSVTVVTTIGYGNLCPSTAGARAFCVVYALFGIPLNL 141

  Fly   135 ILFAGLGE----YFGRTFEAIYRRYKKYKMSTDMHYVPPQLGLITTVVIALIPGIALFLLLPSWV 195
            ||...:|:    ...|..:.:.:|.::.:::.           :.|...||:.|:.||:|||..:
 Frog   142 ILLNRIGQKMLSLVHRCGDVVGKRIRRQRLTK-----------LVTSGSALLIGLLLFMLLPPVL 195

  Fly   196 FTYFENWPYSISLYYSYVTTTTIGFGDYVPTFGANQPKEFGGWFVVYQIFVIVWFIFSLGYLVM 259
            |...|.|.|...||||::|..||||||||  .|.|..|::..|   |:..:.||.:|.|.:|.:
 Frog   196 FRAVEGWTYGEGLYYSFITLATIGFGDYV--VGRNPDKQYPNW---YRNLLSVWILFGLAWLAL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ork1NP_001285097.1 Ion_trans_2 <90..144 CDD:285168 23/57 (40%)
Ion_trans_2 185..269 CDD:285168 32/75 (43%)
LOC101731658XP_031758165.1 Ion_trans_2 92..151 CDD:400301 23/58 (40%)
Ion_trans_2 194..264 CDD:400301 27/66 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9761
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.